AMPDB_51 | Plantazolicin

PEPTIDE SUMMARY

Plantazolicin

1 General Description

AMPDB ID: AMPDB_51

Protein Names: Plantazolicin (PZN) (Plantazolicin A) (Plantazolicin B) (cpd1335)

Protein Family: Nil

Gene Name: pznA ptnA RBAM_007445

Source Organism: Bacillus velezensis (strain DSM 23117 BGSC 10A6 LMG 26770 FZB42) (Bacillus amyloliquefaciens subsp. plantarum)

Protein Length: 41 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MTQIKVPTALIASVHGEGQHLFEPMAARCTCTTIISSSSTF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 1, 'N': 0, 'D': 0, 'C': 2, 'Q': 2, 'E': 2, 'G': 2, 'H': 2, 'I': 4, 'L': 2, 'K': 1, 'M': 2, 'F': 2, 'P': 2, 'S': 5, 'T': 6, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 9.76%, 'R': 2.44%, 'N': 0%, 'D': 0%, 'C': 4.88%, 'Q': 4.88%, 'E': 4.88%, 'G': 4.88%, 'H': 4.88%, 'I': 9.76%, 'L': 4.88%, 'K': 2.44%, 'M': 4.88%, 'F': 4.88%, 'P': 4.88%, 'S': 12.2%, 'T': 14.63%, 'W': 0%, 'Y': 0%, 'V': 4.88%

Missing Amino Acid(s)

D, N, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

K, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4366.06 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.976	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.276	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.356	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.338	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.42	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.059	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.244, 0.22, 0.244 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.049	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.brevis (Gram-positive), B.cereus (Gram-positive), B.licheniformis (Gram-positive), B.subtilis (Gram-positive), E.coli (Gram-negative), E.faecalis (Gram-positive), L.monocytogenes (Gram-positive), M.luteus (Gram-negative), P.granivorans (Gram-positive), Pseudomonas sp. (Gram-negative), S.aureus (Gram-positive), S.pyogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-MRSA, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Scholz R, Molohon KJ, Nachtigall J, et al. Plantazolicin, a novel microcin B17/streptolysin S-like natural product from Bacillus amyloliquefaciens FZB42. J Bacteriol. 2011;193(1):215-24. Published 2011 Jan. doi:10.1128/JB.00784-10

PMID: 20971906

Citation 2: Chen XH, Koumoutsi A, Scholz R, et al. Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42. Nat Biotechnol. 2007;25(9):1007-14. Published 2007 Sep. doi:10.1038/nbt1325

PMID: 17704766

Citation 3: Molohon KJ, Melby JO, Lee J, et al. Structure determination and interception of biosynthetic intermediates for the plantazolicin class of highly discriminating antibiotics. ACS Chem Biol. 2011;6(12):1307-13. Published 2011 Dec 16. doi:10.1021/cb200339d

PMID: 21950656

Citation 4: Kalyon B, Helaly SE, Scholz R, et al. Plantazolicin A and B: structure elucidation of ribosomally synthesized thiazole/oxazole peptides from Bacillus amyloliquefaciens FZB42. Org Lett. 2011;13(12):2996-9. Published 2011 Jun 17. doi:10.1021/ol200809m

PMID: 21568297

5.2 Protein Sequence Databases

UniProt: D3VML5

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: D3VML5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FN668567	GenBank \|\| EMBL
2.	CP000560	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR026474

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download