AMPDB_508 | Mucroporin

1 General Description

AMPDB ID: AMPDB_508

Protein Names: Mucroporin (Antimicrobial peptide 36.21) (Non-disulfide-bridged peptide 4.5) (NDBP-4.5)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Lychas mucronatus (Chinese swimming scorpion)

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKVKFLLAVFLIVLVVTDHCHALFGLIPSLIGGLVSAFKGRRKRQMEARFEPQNRNYRKRELDLEKLFANMPDY

FASTA format

Counts of Amino Acids

'A': 5, 'R': 7, 'N': 3, 'D': 3, 'C': 1, 'Q': 2, 'E': 4, 'G': 4, 'H': 2, 'I': 3, 'L': 11, 'K': 6, 'M': 3, 'F': 6, 'P': 3, 'S': 2, 'T': 1, 'W': 0, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 6.76%, 'R': 9.46%, 'N': 4.05%, 'D': 4.05%, 'C': 1.35%, 'Q': 2.7%, 'E': 5.41%, 'G': 5.41%, 'H': 2.7%, 'I': 4.05%, 'L': 14.86%, 'K': 8.11%, 'M': 4.05%, 'F': 8.11%, 'P': 4.05%, 'S': 2.7%, 'T': 1.35%, 'W': 0%, 'Y': 2.7%, 'V': 8.11%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8650.32 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	104.054	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.655	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.001	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.53	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.621	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.123	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.378, 0.162, 0.311 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.108	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.subtilis (Gram-positive), B.thuringiensis (Gram-positive), E.coli (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Antiviral protein, Anti-HIV, Anti-MRSA, Anti-hepatities, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Dai C, Ma Y, Zhao Z, et al. Mucroporin, the first cationic host defense peptide from the venom of Lychas mucronatus. Antimicrob Agents Chemother. 2008;52(11):3967-72. Published 2008 Nov. doi:10.1128/AAC.00542-08

PMID: 18779362

Citation 2: Ruiming Z, Yibao M, Yawen H, et al. Comparative venom gland transcriptome analysis of the scorpion Lychas mucronatus reveals intraspecific toxic gene diversity and new venomous components. BMC Genomics. 2010;11:452. Published 2010 Jul 28. doi:10.1186/1471-2164-11-452

PMID: 20663230

Citation 3: Li Q, Zhao Z, Zhou D, et al. Virucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses. Peptides. 2011;32(7):1518-25. Published 2011 Jul. doi:10.1016/j.peptides.2011.05.015

PMID: 21620914

Citation 4: Zhao Z, Hong W, Zeng Z, et al. Mucroporin-M1 inhibits hepatitis B virus replication by activating the mitogen-activated protein kinase (MAPK) pathway and down-regulating HNF4Î± in vitro and in vivo. J Biol Chem. 2012;287(36):30181-90. Published 2012 Aug 31. doi:10.1074/jbc.M112.370312

PMID: 22791717

Citation 5: Chen Y, Cao L, Zhong M, et al. Anti-HIV-1 activity of a new scorpion venom peptide derivative Kn2-7. PLoS One. 2012;7(4):e34947. Published 2012. doi:10.1371/journal.pone.0034947

PMID: 22536342

Citation 6: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: B9UIY3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU669864	GenBank \|\| EMBL
2.	GT028857	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download