AMPDB_507 | Domesticated amidase effector 2

PEPTIDE SUMMARY

Domesticated amidase effector 2

1 General Description

AMPDB ID: AMPDB_507

Protein Names: Domesticated amidase effector 2 (Dae2) (EC 3.4.-.-) (Peptidoglycan endopeptidase Dae2)

Protein Family: Nil

Gene Name: IscW_ISCW006596 XP_002434728

Source Organism: Ixodes scapularis (Black-legged tick) (Deer tick)

Protein Length: 142 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKLFLISAALVVLGLAAVADAIGCSDPSPFQGRWVIGVDKKECVALVKEKCGNLRDYTTGRWVRGQHVKSNCGSIPKFTAIATFLKPGNKYLGHAAIFESCASDGIWVYDQWNAKPVERRKIRYGNTGKPNYNGDNFYTIEL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 7, 'N': 8, 'D': 7, 'C': 5, 'Q': 3, 'E': 5, 'G': 14, 'H': 2, 'I': 9, 'L': 10, 'K': 12, 'M': 1, 'F': 6, 'P': 6, 'S': 7, 'T': 6, 'W': 4, 'Y': 6, 'V': 11

Frequencies of Amino Acids

'A': 9.15%, 'R': 4.93%, 'N': 5.63%, 'D': 4.93%, 'C': 3.52%, 'Q': 2.11%, 'E': 3.52%, 'G': 9.86%, 'H': 1.41%, 'I': 6.34%, 'L': 7.04%, 'K': 8.45%, 'M': 0.7%, 'F': 4.23%, 'P': 4.23%, 'S': 4.93%, 'T': 4.23%, 'W': 2.82%, 'Y': 4.23%, 'V': 7.75%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15688.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.803	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.63	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.157	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.546	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.453	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.873	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.324, 0.246, 0.204 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.113	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	30940, 31190	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Tick

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial

4.3 Enzymatic Activity

Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Chou S, Daugherty MD, Peterson SB, et al. Transferred interbacterial antagonism genes augment eukaryotic innate immune function. Nature. 2015;518(7537):98-101. Published 2015 Feb 5. doi:10.1038/nature13965

PMID: 25470067

Citation 2: Smith AA, Navasa N, Yang X, et al. Cross-Species Interferon Signaling Boosts Microbicidal Activity within the Tick Vector. Cell Host Microbe. 2016;20(1):91-8. Published 2016 Jul 13. doi:10.1016/j.chom.2016.06.001

PMID: 27374407

Citation 3: Hayes BM, Radkov AD, Yarza F, et al. Ticks Resist Skin Commensals with Immune Factor of Bacterial Origin. Cell. 2020;183(6):1562-1571.e12. Published 2020 Dec 10. doi:10.1016/j.cell.2020.10.042

PMID: 33306955

5.2 Protein Sequence Databases

UniProt: B7PLT0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B7PLT0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	ABJB010223783	GenBank \|\| EMBL
2.	DS742756	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_002434728.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: isc:IscW_ISCW006596

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download