AMPDB_505 | Preprofallaxidin-9

PEPTIDE SUMMARY

Preprofallaxidin-9

1 General Description

AMPDB ID: AMPDB_505

Protein Names: Preprofallaxidin-9 [Cleaved into: Fallaxidin-2.1; Fallaxidin-3.2]

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: Nil

Source Organism: Litoria fallax (Eastern dwarf tree frog) (Hylomantis fallax)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MASLKKSLFLVLFLGLVSLSICEEEKRENEEDAEDENHEEESEEKRGLLDFAKHVIGIASKLGKRSEEKRFWPFMGKRSEEKRFWPFMGKRSEE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 7, 'N': 2, 'D': 3, 'C': 1, 'Q': 0, 'E': 19, 'G': 6, 'H': 2, 'I': 3, 'L': 10, 'K': 11, 'M': 3, 'F': 7, 'P': 2, 'S': 9, 'T': 0, 'W': 2, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 4.26%, 'R': 7.45%, 'N': 2.13%, 'D': 3.19%, 'C': 1.06%, 'Q': 0%, 'E': 20.21%, 'G': 6.38%, 'H': 2.13%, 'I': 3.19%, 'L': 10.64%, 'K': 11.7%, 'M': 3.19%, 'F': 7.45%, 'P': 2.13%, 'S': 9.57%, 'T': 0%, 'W': 2.13%, 'Y': 0%, 'V': 3.19%

Missing Amino Acid(s)

Q, T, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11094.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	67.447	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	92.035	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.854	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.699	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.068	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.85	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.266, 0.202, 0.383 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.096	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11000, 11000	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cereus (Gram-positive), E.cloacae (Gram-negative), E.faecalis (Gram-positive), L.innocua (Gram-positive), L.lactis (Gram-positive), M.luteus (Gram-negative), S.aureus (Gram-positive), S.epidermidis (Gram-positive), S.uberis (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Jackway RJ, Bowie JH, Bilusich D, et al. The fallaxidin peptides from the skin secretion of the Eastern Dwarf Tree Frog Litoria fallax. Sequence determination by positive and negative ion electrospray mass spectrometry: antimicrobial activity and cDNA cloning of the fallaxidins. Rapid Commun Mass Spectrom. 2008;22(20):3207-16. Published 2008 Oct. doi:10.1002/rcm.3723

PMID: 18803332

5.2 Protein Sequence Databases

UniProt: B5LUR1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B5LUR1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU912536	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download