AMPDB_5 | Protein GPR15LG

1 General Description

AMPDB ID: AMPDB_5

Protein Names: Protein GPR15LG (Protein GPR15 ligand) (Protein GPR15L)

Protein Family: Nil

Gene Name: Gpr15lg Gpr15l

Source Organism: Mus musculus (Mouse)

Protein Length: 78 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MRLLALSGLLCMLLLCFCIFSSEGRRHPAKSLKLRRCCHLSPRSKLTTWKGNHTRPCRLCRNKLPVKSWVVPGALPQI

FASTA format

Counts of Amino Acids

'A': 3, 'R': 9, 'N': 2, 'D': 0, 'C': 7, 'Q': 1, 'E': 1, 'G': 4, 'H': 3, 'I': 2, 'L': 15, 'K': 6, 'M': 2, 'F': 2, 'P': 6, 'S': 7, 'T': 3, 'W': 2, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 3.85%, 'R': 11.54%, 'N': 2.56%, 'D': 0%, 'C': 8.97%, 'Q': 1.28%, 'E': 1.28%, 'G': 5.13%, 'H': 3.85%, 'I': 2.56%, 'L': 19.23%, 'K': 7.69%, 'M': 2.56%, 'F': 2.56%, 'P': 7.69%, 'S': 8.97%, 'T': 3.85%, 'W': 2.56%, 'Y': 0%, 'V': 3.85%

Missing Amino Acid(s)

D, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8898.88 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	100	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	60.724	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.035	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.622	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.551	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	13.837	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.308, 0.244, 0.269 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.051	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11000, 11375	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Actinomyces (Gram-positive), Mycoplasma (Gram-negative), Staphylococcus aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytokine, Anti-cancer, Chemotaxis, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Church DM, Goodstadt L, Hillier LW, et al. Lineage-specific biology revealed by a finished genome assembly of the mouse. PLoS Biol. 2009;7(5):e1000112. Published 2009 May 5. doi:10.1371/journal.pbio.1000112

PMID: 19468303

Citation 2: OcÃ³n B, Pan J, Dinh TT, et al. A Mucosal and Cutaneous Chemokine Ligand for the Lymphocyte Chemoattractant Receptor GPR15. Front Immunol. 2017;8:1111. Published 2017. doi:10.3389/fimmu.2017.01111

PMID: 28936214

Citation 3: Suply T, Hannedouche S, Carte N, et al. A natural ligand for the orphan receptor GPR15 modulates lymphocyte recruitment to epithelia. Sci Signal. 2017;10(496). Published 2017 Sep 12. doi:10.1126/scisignal.aal0180

PMID: 28900043

Citation 4: Chen C, Wu N, Duan Q, et al. C10orf99 contributes to the development of psoriasis by promoting the proliferation of keratinocytes. Sci Rep. 2018;8(1):8590. Published 2018 Jun 5. doi:10.1038/s41598-018-26996-z

PMID: 29872130

Citation 5: Tseng PY, Hoon MA, Hoon MA. GPR15L is an epithelial inflammation-derived pruritogen. Sci Adv. 2022;8(24):eabm7342. Published 2022 Jun 17. doi:10.1126/sciadv.abm7342

PMID: 35704588

5.2 Protein Sequence Databases

UniProt: A0A0B4J1N3

5.3 3D Structure Databases

AlphaFoldDB: A0A0B4J1N3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	CT009495	GenBank \|\| EMBL
2.	CH466573	GenBank \|\| EMBL

CCDS: CCDS56949.1

RefSeq: NP_001193613.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR031713

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00390000015172

5.9 Phylogenomic Databases

GeneTree: ENSGT00390000015172

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: A0A0B4J1N3

Download