AMPDB_490 | Longicornsin
PEPTIDE SUMMARY
Longicornsin
1 General Description
AMPDB ID: AMPDB_490
Protein Names: Longicornsin
Protein Family: Invertebrate defensin family; Type 2 subfamily
Gene Name: sGDLP
Protein Length: 78 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MAESTTTCFLLLVTGYVTAVMSEEAHLRSRRDFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 9, 'N': 0, 'D': 2, 'C': 7, 'Q': 2, 'E': 3, 'G': 8, 'H': 2, 'I': 2, 'L': 6, 'K': 0, 'M': 7, 'F': 6, 'P': 4, 'S': 4, 'T': 7, 'W': 0, 'Y': 2, 'V': 4
Frequencies of Amino Acids
'A': 3.85%, 'R': 11.54%, 'N': 0%, 'D': 2.56%, 'C': 8.97%, 'Q': 2.56%, 'E': 3.85%, 'G': 10.26%, 'H': 2.56%, 'I': 2.56%, 'L': 7.69%, 'K': 0%, 'M': 8.97%, 'F': 7.69%, 'P': 5.13%, 'S': 5.13%, 'T': 8.97%, 'W': 0%, 'Y': 2.56%, 'V': 5.13%
Missing Amino Acid(s)
K, N, W
Most Occurring Amino Acid(s)
R
Less Occurring Amino Acid(s)
D, H, I, Q, Y
Hydrophobic Amino Acid(s) Count
40
Hydrophilic Amino Acid(s) Count
38
Basic Amino Acid(s) Count
5
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8837.47 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 58.718 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 65.481 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.127 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.728 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.506 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 3.75 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.256, 0.205, 0.244 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.103 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 2980, 3355 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
C.albidus, E.coli (Gram-negative), H.pylori (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Lu X, Che Q, Lv Y, et al. A novel defensin-like peptide from salivary glands of the hard tick, Haemaphysalis longicornis. Protein Sci. 2010;19(3):392-7. Published 2010 Mar. doi:10.1002/pro.317
PMID: 20027626
5.2 Protein Sequence Databases
UniProt: B2MW54
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: B2MW54
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. EU627689 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India