AMPDB_49 | Baramicin A1

1 General Description

AMPDB ID: AMPDB_49

Protein Names: Baramicin A1 [Cleaved into: Immune-induced peptide 24 (DIM-24) (DIM24) (IM24); Immune-induced peptide 10 (DIM-10) (DIM10) (IM10); Immune-induced peptide 12 (DIM-12) (DIM12) (IM12); Immune-induced peptide 13 (DIM-13) (DIM13) (IM13); Immune-induced peptide 22 (DIM-22) (DIM22) (IM22); Immune-induced peptide 5 (DIM-5) (DIM5) (IM5); Immune-induced peptide 6 (DIM-6) (DIM6) (IM6); Immune-induced peptide 8 (DIM-8) (DIM8) (IM8)]

Protein Family: Nil

Gene Name: BaraA1 IMPPP CG33470

Source Organism: Drosophila melanogaster (Fruit fly)

Protein Length: 257 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKSFGLIALAICGVICVAAEPQHTYDGRNGPHVFGSPGNQVYIRGQNEGTYSVPGVGGQFQNAPQRGEHVYTDEAGNTFVNRKNAGGPASHTISGPNFSAKNLGPNGAKSVGIPQRARRSPQFHVERPGRTVDVGNGGFYIQRGRRSPQLHVARPDRTVTIGNGGVYIQRSRRSPQFHVERPDRTVDFGNGGFSAQRFRRGINDARVQGENFVARDDQAGIWDNNVSVWKRPDGRTVTIDRNGHTIVSGRGRPAQHY

FASTA format

Counts of Amino Acids

'A': 17, 'R': 29, 'N': 18, 'D': 12, 'C': 2, 'Q': 16, 'E': 7, 'G': 37, 'H': 9, 'I': 13, 'L': 4, 'K': 5, 'M': 1, 'F': 12, 'P': 17, 'S': 14, 'T': 12, 'W': 2, 'Y': 7, 'V': 23

Frequencies of Amino Acids

'A': 6.61%, 'R': 11.28%, 'N': 7%, 'D': 4.67%, 'C': 0.78%, 'Q': 6.23%, 'E': 2.72%, 'G': 14.4%, 'H': 3.5%, 'I': 5.06%, 'L': 1.56%, 'K': 1.95%, 'M': 0.39%, 'F': 4.67%, 'P': 6.61%, 'S': 5.45%, 'T': 4.67%, 'W': 0.78%, 'Y': 2.72%, 'V': 8.95%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

126

Hydrophilic Amino Acid(s) Count

131

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	28036 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	58.366	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	34.291	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.76	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.786	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.285	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	15.703	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.237, 0.335, 0.113 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	21430, 21555	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.bassiana, M.rileyi

4.2 Antimicrobial Activity

Antimicrobial, Fungicide

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Signal peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185

PMID: 10731132

Citation 2: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083

PMID: 12537572

Citation 3: Hild M, Beckmann B, Haas SA, et al. An integrated gene annotation and transcriptional profiling approach towards the full gene content of the Drosophila genome. Genome Biol. 2003;5(1):R3. Published 2003. doi:10.1186/gb-2003-5-1-r3

PMID: 14709175

Citation 4: Uttenweiler-Joseph S, Moniatte M, Lagueux M, et al. Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study. Proc Natl Acad Sci U S A. 1998;95(19):11342-7. Published 1998 Sep 15. doi:10.1073/pnas.95.19.11342

PMID: 9736738

Citation 5: Verleyen P, Baggerman G, D'Hertog W, et al. Identification of new immune induced molecules in the haemolymph of Drosophila melanogaster by 2D-nanoLC MS/MS. J Insect Physiol. 2006;52(4):379-88. Published 2006 Apr. doi:10.1016/j.jinsphys.2005.12.007

PMID: 16510152

Citation 6: Hanson MA, Cohen LB, Marra A, et al. The Drosophila Baramicin polypeptide gene protects against fungal infection. PLoS Pathog. 2021;17(8):e1009846. Published 2021 Aug. doi:10.1371/journal.ppat.1009846

PMID: 34432851

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: C0HLZ9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AE013599	GenBank \|\| EMBL
2.	AE013599	GenBank \|\| EMBL
3.	BK003775	GenBank \|\| EMBL
4.	BT003754	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download