AMPDB_488 | Mannose-specific lectin

PEPTIDE SUMMARY

Mannose-specific lectin

1 General Description

AMPDB ID: AMPDB_488

Protein Names: Mannose-specific lectin (Agglutinin)

Protein Family: Nil

Gene Name: dfa

Source Organism: Dendrobium findlayanum (Findlay`s orchid)

Protein Length: 167 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFSISSTMIFLLSLALFSTLVSADNHLLPGERLNPGNFLKQDRYMLIMQEDCNLVLYNLNKPEWATKTANQGSRCFVTLQSDGNFVIYDEHEQEGRNEAIWASKTDGENGNYVIILQKDGNLVLYSKPIFATGTNRFGSTAVVVAKRNRKAHFGVEQNIIEVTTNL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 7, 'N': 16, 'D': 7, 'C': 2, 'Q': 7, 'E': 10, 'G': 11, 'H': 3, 'I': 10, 'L': 18, 'K': 8, 'M': 4, 'F': 9, 'P': 4, 'S': 11, 'T': 11, 'W': 2, 'Y': 5, 'V': 11

Frequencies of Amino Acids

'A': 6.59%, 'R': 4.19%, 'N': 9.58%, 'D': 4.19%, 'C': 1.2%, 'Q': 4.19%, 'E': 5.99%, 'G': 6.59%, 'H': 1.8%, 'I': 5.99%, 'L': 10.78%, 'K': 4.79%, 'M': 2.4%, 'F': 5.39%, 'P': 2.4%, 'S': 6.59%, 'T': 6.59%, 'W': 1.2%, 'Y': 2.99%, 'V': 6.59%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	18738.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.078	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.716	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.184	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.643	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.254	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.839	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.329, 0.251, 0.257 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.096	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	18450, 18575	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.alternata, Collectotrichum

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Lectin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Sattayasai N, Sudmoon R, Nuchadomrong S, et al. Dendrobium findleyanum agglutinin: production, localization, anti-fungal activity and gene characterization. Plant Cell Rep. 2009;28(8):1243-52. Published 2009 Aug. doi:10.1007/s00299-009-0724-0

PMID: 19495769

Citation 2: Sudmoon R, Sattayasai N, Bunyatratchata W, et al. Thermostable mannose-binding lectin from Dendrobium findleyanum with activities dependent on sulfhydryl content. Acta Biochim Biophys Sin (Shanghai). 2008;40(9):811-8. Published 2008 Sep. doi:

PMID: 18776994

5.2 Protein Sequence Databases

UniProt: B2KNH9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B2KNH9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EF577046	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001480, IPR036426

PANTHER: Not found

PROSITE: PS50927

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download