AMPDB_487 | Defensin coprisin

1 General Description

AMPDB ID: AMPDB_487

Protein Names: Defensin coprisin

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Copris tripartitus (Dung beetle)

Protein Length: 80 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN

FASTA format

Counts of Amino Acids

'A': 9, 'R': 4, 'N': 4, 'D': 1, 'C': 8, 'Q': 3, 'E': 5, 'G': 5, 'H': 2, 'I': 3, 'L': 10, 'K': 5, 'M': 2, 'F': 2, 'P': 2, 'S': 5, 'T': 1, 'W': 0, 'Y': 0, 'V': 9

Frequencies of Amino Acids

'A': 11.25%, 'R': 5%, 'N': 5%, 'D': 1.25%, 'C': 10%, 'Q': 3.75%, 'E': 6.25%, 'G': 6.25%, 'H': 2.5%, 'I': 3.75%, 'L': 12.5%, 'K': 6.25%, 'M': 2.5%, 'F': 2.5%, 'P': 2.5%, 'S': 6.25%, 'T': 1.25%, 'W': 0%, 'Y': 0%, 'V': 11.25%

Missing Amino Acid(s)

W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8560.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	107.25	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	43.483	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.445	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.457	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.215	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.692	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.3, 0.2, 0.325 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.025	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 500	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.epidermidis (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Anti-inflammatory, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Hwang JS, Lee J, Kim YJ, et al. Isolation and Characterization of a Defensin-Like Peptide (Coprisin) from the Dung Beetle, Copris tripartitus. Int J Pept. 2009;2009. Published 2009. doi:10.1155/2009/136284

PMID: 20721297

Citation 2: Lee J, Hwang JS, Hwang IS, et al. Coprisin-induced antifungal effects in Candida albicans correlate with apoptotic mechanisms. Free Radic Biol Med. 2012;52(11-12):2302-11. Published 2012 Jun 1-15. doi:10.1016/j.freeradbiomed.2012.03.012

PMID: 22542795

Citation 3: Lee JH, Kim IW, Shin YP, et al. Enantiomeric CopA3 dimer peptide suppresses cell viability and tumor xenograft growth of human gastric cancer cells. Tumour Biol. 2016;37(3):3237-45. Published 2016 Mar. doi:10.1007/s13277-015-4162-z

PMID: 26432335

Citation 4: Lee J, Kim S, Sim JY, et al. A potent antibacterial activity of new short d-enantiomeric lipopeptide against multi drug resistant bacteria. Biochim Biophys Acta Biomembr. 2019;1861(1):34-42. Published 2019 Jan. doi:10.1016/j.bbamem.2018.10.014

PMID: 30393205

Citation 5: Lee E, Kim JK, Shin S, et al. Insight into the antimicrobial activities of coprisin isolated from the dung beetle, Copris tripartitus, revealed by structure-activity relationships. Biochim Biophys Acta. 2013;1828(2):271-83. Published 2013 Feb. doi:10.1016/j.bbamem.2012.10.028

PMID: 23137439

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: A9XFZ7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EF208958	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download