AMPDB_486 | Bacteriocin ubericin-A
PEPTIDE SUMMARY
Bacteriocin ubericin-A
1 General Description
AMPDB ID: AMPDB_486
Protein Names: Bacteriocin ubericin-A
Protein Family: Bacteriocin class IIA YGNGV family
Gene Name: ubaA
Source Organism: Streptococcus uberis
Protein Length: 70 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MNTIEKFENIKLFSLKKIIGGKTVNYGNGLYCNQKKCWVNWSETATTIVNNSIMNGLTGGNAGWHSGGRA
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 1, 'N': 10, 'D': 0, 'C': 2, 'Q': 1, 'E': 3, 'G': 10, 'H': 1, 'I': 6, 'L': 4, 'K': 7, 'M': 2, 'F': 2, 'P': 0, 'S': 4, 'T': 6, 'W': 3, 'Y': 2, 'V': 3
Frequencies of Amino Acids
'A': 4.29%, 'R': 1.43%, 'N': 14.29%, 'D': 0%, 'C': 2.86%, 'Q': 1.43%, 'E': 4.29%, 'G': 14.29%, 'H': 1.43%, 'I': 8.57%, 'L': 5.71%, 'K': 10%, 'M': 2.86%, 'F': 2.86%, 'P': 0%, 'S': 5.71%, 'T': 8.57%, 'W': 4.29%, 'Y': 2.86%, 'V': 4.29%
Missing Amino Acid(s)
D, P
Most Occurring Amino Acid(s)
G, N
Less Occurring Amino Acid(s)
H, Q, R
Hydrophobic Amino Acid(s) Count
33
Hydrophilic Amino Acid(s) Count
37
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
9
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7680.78 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 72.429 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 17.573 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.373 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.439 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.075 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 4.967 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.286, 0.343, 0.171 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.1 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 19480, 19605 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.faecalis (Gram-positive), E.hirae (Gram-positive), Listeria (Gram-positive), S.bovis (Gram-negative), S.uberis (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Heng NC, Burtenshaw GA, Jack RW, et al. Ubericin A, a class IIa bacteriocin produced by Streptococcus uberis. Appl Environ Microbiol. 2007;73(23):7763-6. Published 2007 Dec. doi:10.1128/AEM.01818-07
PMID: 17933926
5.2 Protein Sequence Databases
UniProt: A9Q0M7
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: A9Q0M7
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. EF203953 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: PS60030
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India