AMPDB_4828 | Lantibiotic

PEPTIDE SUMMARY

Lantibiotic

1 General Description

AMPDB ID: AMPDB_4828

Protein Names: Lantibiotic

Protein Family: Type A lantibiotic family

Gene Name: bceA

Source Organism: Bacillus cereus

Protein Length: 55 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

METEKYLQVVEDEEIEQLVGGAGPGWVETLTKDCPWNMPVACVTILGQRICKKCY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 1, 'N': 1, 'D': 2, 'C': 4, 'Q': 3, 'E': 7, 'G': 5, 'H': 0, 'I': 3, 'L': 4, 'K': 4, 'M': 2, 'F': 0, 'P': 3, 'S': 0, 'T': 4, 'W': 2, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 3.64%, 'R': 1.82%, 'N': 1.82%, 'D': 3.64%, 'C': 7.27%, 'Q': 5.45%, 'E': 12.73%, 'G': 9.09%, 'H': 0%, 'I': 5.45%, 'L': 7.27%, 'K': 7.27%, 'M': 3.64%, 'F': 0%, 'P': 5.45%, 'S': 0%, 'T': 7.27%, 'W': 3.64%, 'Y': 3.64%, 'V': 10.91%

Missing Amino Acid(s)

F, H, S

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

N, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6203.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	84.909	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	67.444	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.151	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.5	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.194	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.239	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.309, 0.164, 0.273 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.073	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14230	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: A0A023Q0A7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A023Q0A7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KJ504103	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007682

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download