AMPDB_48 | Galactose-binding lectin

PEPTIDE SUMMARY

Galactose-binding lectin

1 General Description

AMPDB ID: AMPDB_48

Protein Names: Galactose-binding lectin (CCL)

Protein Family: Nil

Gene Name: Nil

Source Organism: Chondrilla caribensis (Chicken liver sponge)

Protein Length: 142 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

TYAEVESFGVGQSATAVYTAPGDGRDLNITIDADGGYVIHMDYRFDWGGNPSTGKPWEDILILNSKPAQTWGPQQHVNNFYFTPGTHVTLGDKSNDGHFAIIADGIQVATYDHRLPVNSVKEVKFSTTAGSGTDIWDLLLLP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 3, 'N': 7, 'D': 13, 'C': 0, 'Q': 5, 'E': 4, 'G': 16, 'H': 5, 'I': 9, 'L': 9, 'K': 5, 'M': 1, 'F': 6, 'P': 8, 'S': 8, 'T': 13, 'W': 4, 'Y': 6, 'V': 10

Frequencies of Amino Acids

'A': 7.04%, 'R': 2.11%, 'N': 4.93%, 'D': 9.15%, 'C': 0%, 'Q': 3.52%, 'E': 2.82%, 'G': 11.27%, 'H': 3.52%, 'I': 6.34%, 'L': 6.34%, 'K': 3.52%, 'M': 0.7%, 'F': 4.23%, 'P': 5.63%, 'S': 5.63%, 'T': 9.15%, 'W': 2.82%, 'Y': 4.23%, 'V': 7.04%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15443 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	76.901	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.295	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.304	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.561	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.474	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-8.541	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.31, 0.275, 0.169 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.113	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	30940, 30940	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), L.infantum, S.aureus (Gram-positive), S.epidermidis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-biofilm, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Lectin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Sousa ARO, Andrade FRN, Chaves RP, et al. Structural characterization of a galectin isolated from the marine sponge Chondrilla caribensis with leishmanicidal potential. Biochim Biophys Acta Gen Subj. 2021;1865(12):129992. Published 2021 Dec. doi:10.1016/j.bbagen.2021.129992

PMID: 34508835

Citation 2: Marques DN, Almeida AS, Sousa ARO, et al. Antibacterial activity of a new lectin isolated from the marine sponge Chondrilla caribensis. Int J Biol Macromol. 2018;109:1292-1301. Published 2018 Apr 1. doi:10.1016/j.ijbiomac.2017.11.140

PMID: 29175164

5.2 Protein Sequence Databases

UniProt: C0HLX7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C0HLX7

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR013320, IPR001079

PANTHER: Not found

PROSITE: PS51304

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download