AMPDB_4719 | Lutzicidin

PEPTIDE SUMMARY

Lutzicidin

1 General Description

AMPDB ID: AMPDB_4719

Protein Names: Lutzicidin (Cathelicidin-related antimicrobial peptide) (CRAMP) (Vipericidin)

Protein Family: Cathelicidin family

Gene Name: Nil

Source Organism: Bothrops lutzi (Sertao lancehead) (Bothrops iglesiasi)

Protein Length: 189 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MQGFFWKTLLVVALCGTSSSLAHRPLSYGEALELALSVYNSKAGEESLFRLLEAVPQPEWDPLSEGSQQLNFTIKETVCQVEEERPLEECGFQEDGVVLECTGYYFFGETPPVVVLTCVPVGGVEEEEEDEEEQKAEVEKDEEKEDEEKDRPKRVKRFKKFFKKLKNNVKKRVKKFFRKPRVIGVTIPF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 9, 'N': 4, 'D': 6, 'C': 5, 'Q': 7, 'E': 31, 'G': 12, 'H': 1, 'I': 3, 'L': 17, 'K': 19, 'M': 1, 'F': 13, 'P': 11, 'S': 9, 'T': 8, 'W': 2, 'Y': 4, 'V': 20

Frequencies of Amino Acids

'A': 3.7%, 'R': 4.76%, 'N': 2.12%, 'D': 3.17%, 'C': 2.65%, 'Q': 3.7%, 'E': 16.4%, 'G': 6.35%, 'H': 0.53%, 'I': 1.59%, 'L': 8.99%, 'K': 10.05%, 'M': 0.53%, 'F': 6.88%, 'P': 5.82%, 'S': 4.76%, 'T': 4.23%, 'W': 1.06%, 'Y': 2.12%, 'V': 10.58%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

103

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	21716.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.661	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	54.168	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.542	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.89	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.635	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-9.172	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.312, 0.19, 0.296 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.101	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	16960, 17210	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Falcao CB, de La Torre BG, PÃ©rez-Peinado C, et al. Vipericidins: a novel family of cathelicidin-related peptides from the venom gland of South American pit vipers. Amino Acids. 2014;46(11):2561-71. Published 2014 Nov. doi:10.1007/s00726-014-1801-4

PMID: 25100358

5.2 Protein Sequence Databases

UniProt: U5KJT7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: U5KJT7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JX948112	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR046350

PANTHER: PTHR10206

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download