AMPDB_4715 | Batroxicidin

PEPTIDE SUMMARY

Batroxicidin

1 General Description

AMPDB ID: AMPDB_4715

Protein Names: Batroxicidin (BatxC) (Cathelicidin-related antimicrobial peptide) (CRAMP) (Vipericidin)

Protein Family: Cathelicidin family

Gene Name: Nil

Source Organism: Bothrops atrox (Barba amarilla) (Fer-de-lance)

Protein Length: 189 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MQGFFWKTWLVVALCGTSSSLAHRPLSYGEALELALSIYNSKAGEESLFRLLEAVPQPEWDPLSEGSQQLNFTIKETVCQVEEERPLEECGFQEDGVVLECTGYYFFGETPPVVVLTCVPVGGVEEEEEDEEEQKAEVEKDEEKEDEEKDRPKRVKRFKKFFKKLKNSVKKRVKKFFRKPRVIGVTFPF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 9, 'N': 3, 'D': 6, 'C': 5, 'Q': 7, 'E': 31, 'G': 12, 'H': 1, 'I': 3, 'L': 16, 'K': 19, 'M': 1, 'F': 14, 'P': 11, 'S': 10, 'T': 8, 'W': 3, 'Y': 4, 'V': 19

Frequencies of Amino Acids

'A': 3.7%, 'R': 4.76%, 'N': 1.59%, 'D': 3.17%, 'C': 2.65%, 'Q': 3.7%, 'E': 16.4%, 'G': 6.35%, 'H': 0.53%, 'I': 1.59%, 'L': 8.47%, 'K': 10.05%, 'M': 0.53%, 'F': 7.41%, 'P': 5.82%, 'S': 5.29%, 'T': 4.23%, 'W': 1.59%, 'Y': 2.12%, 'V': 10.05%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

103

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	21810.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	72.064	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	56.249	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.56	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.89	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.635	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-9.172	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.312, 0.19, 0.291 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.111	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	22460, 22710	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), E.faecalis (Gram-positive), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), Trypanosoma cruzi

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-parasitic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Falcao CB, de La Torre BG, PÃ©rez-Peinado C, et al. Vipericidins: a novel family of cathelicidin-related peptides from the venom gland of South American pit vipers. Amino Acids. 2014;46(11):2561-71. Published 2014 Nov. doi:10.1007/s00726-014-1801-4

PMID: 25100358

Citation 2: Mello CP, Lima DB, Menezes RR, et al. Evaluation of the antichagasic activity of batroxicidin, a cathelicidin-related antimicrobial peptide found in Bothrops atrox venom gland. Toxicon. 2017;130:56-62. Published 2017 May. doi:10.1016/j.toxicon.2017.02.031

PMID: 28246023

5.2 Protein Sequence Databases

UniProt: U5KJC9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: U5KJC9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JX948111	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR046350

PANTHER: PTHR10206

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download