AMPDB_4640 | Bradykinin-potentiating peptide BmKbpp

PEPTIDE SUMMARY

Bradykinin-potentiating peptide BmKbpp

1 General Description

AMPDB ID: AMPDB_4640

Protein Names: Bradykinin-potentiating peptide BmKbpp (Bpp BmK3) (Non-disulfide-bridged peptide 2.2) (NDBP-2.2) (Non-disulfide-bridged peptide 3.3) (NDBP-3.3)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Long chain multifunctional peptide (group 2) family

Gene Name: Nil

Source Organism: Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Protein Length: 72 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MNKKTLLVIFFVTMLIVDEVNSFRFGSFLKKVWKSKLAKKLRSKGKQLLKDYANKVLNGPEEEAAAPAERRR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 5, 'N': 4, 'D': 2, 'C': 0, 'Q': 1, 'E': 5, 'G': 3, 'H': 0, 'I': 2, 'L': 9, 'K': 12, 'M': 2, 'F': 5, 'P': 2, 'S': 4, 'T': 2, 'W': 1, 'Y': 1, 'V': 6

Frequencies of Amino Acids

'A': 8.33%, 'R': 6.94%, 'N': 5.56%, 'D': 2.78%, 'C': 0%, 'Q': 1.39%, 'E': 6.94%, 'G': 4.17%, 'H': 0%, 'I': 2.78%, 'L': 12.5%, 'K': 16.67%, 'M': 2.78%, 'F': 6.94%, 'P': 2.78%, 'S': 5.56%, 'T': 2.78%, 'W': 1.39%, 'Y': 1.39%, 'V': 8.33%

Missing Amino Acid(s)

C, H

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Q, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8326.93 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.083	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	48.558	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.354	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.765	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.087	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.003	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.333, 0.181, 0.306 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.097	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Metalloenzyme inhibitor, Metalloprotease inhibitor

4.5 Other Biological Activity

Toxin, Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zeng XC, Li WX, Peng F, et al. Cloning and characterization of a novel cDNA sequence encoding the precursor of a novel venom peptide (BmKbpp) related to a bradykinin-potentiating peptide from Chinese scorpion Buthus martensii Karsch. IUBMB Life. 2000;49(3):207-10. Published 2000 Mar. doi:10.1080/713803610

PMID: 10868911

Citation 2: Zeng XC, Wang S, Nie Y, et al. Characterization of BmKbpp, a multifunctional peptide from the Chinese scorpion Mesobuthus martensii Karsch: gaining insight into a new mechanism for the functional diversification of scorpion venom peptides. Peptides. 2012;33(1):44-51. Published 2012 Jan. doi:10.1016/j.peptides.2011.11.012

PMID: 22115565

Citation 3: Zeng XC, Corzo G, Hahin R, et al. Scorpion venom peptides without disulfide bridges. IUBMB Life. 2005;57(1):13-21. Published 2005 Jan. doi:10.1080/15216540500058899

PMID: 16036557

Citation 4: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: Q9Y0X4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q9Y0X4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF146744	GenBank \|\| EMBL
2.	AF145952	GenBank \|\| EMBL
3.	AF145953	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download