AMPDB_4627 | WAP four-disulfide core domain protein 15B

1 General Description

AMPDB ID: AMPDB_4627

Protein Names: WAP four-disulfide core domain protein 15B (Elafin-like protein I) (Single WAP motif protein 1)

Protein Family: Nil

Gene Name: Wfdc15b Swam1 Wfdc15

Source Organism: Mus musculus (Mouse)

Protein Length: 80 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MKLLGLSLLAVTILLCCNMARPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWESPE

FASTA format

Counts of Amino Acids

'A': 3, 'R': 5, 'N': 2, 'D': 3, 'C': 10, 'Q': 1, 'E': 4, 'G': 3, 'H': 0, 'I': 3, 'L': 9, 'K': 9, 'M': 3, 'F': 4, 'P': 8, 'S': 3, 'T': 1, 'W': 1, 'Y': 3, 'V': 5

Frequencies of Amino Acids

'A': 3.75%, 'R': 6.25%, 'N': 2.5%, 'D': 3.75%, 'C': 12.5%, 'Q': 1.25%, 'E': 5%, 'G': 3.75%, 'H': 0%, 'I': 3.75%, 'L': 11.25%, 'K': 11.25%, 'M': 3.75%, 'F': 5%, 'P': 10%, 'S': 3.75%, 'T': 1.25%, 'W': 1.25%, 'Y': 3.75%, 'V': 6.25%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Q, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9237.24 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.375	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.069	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.019	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.565	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.719	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.381	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.313, 0.2, 0.238 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.1	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 10595	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Hagiwara K, Kikuchi T, Endo Y, et al. Mouse SWAM1 and SWAM2 are antibacterial proteins composed of a single whey acidic protein motif. J Immunol. 2003;170(4):1973-9. Published 2003 Feb 15. doi:10.4049/jimmunol.170.4.1973

PMID: 12574366

Citation 2: Carninci P, Kasukawa T, Katayama S, et al. The transcriptional landscape of the mammalian genome. Science. 2005;309(5740):1559-63. Published 2005 Sep 2. doi:10.1126/science.1112014

PMID: 16141072

Citation 3: Church DM, Goodstadt L, Hillier LW, et al. Lineage-specific biology revealed by a finished genome assembly of the mouse. PLoS Biol. 2009;7(5):e1000112. Published 2009 May 5. doi:10.1371/journal.pbio.1000112

PMID: 19468303

Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 5: Clauss A, Lilja H, Lundwall A, et al. The evolution of a genetic locus encoding small serine proteinase inhibitors. Biochem Biophys Res Commun. 2005;333(2):383-9. Published 2005 Jul 29. doi:10.1016/j.bbrc.2005.05.125

PMID: 15950183

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q9JHY4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF276974	GenBank \|\| EMBL
2.	AF482009	GenBank \|\| EMBL
3.	AK078998	GenBank \|\| EMBL
4.	AK085392	GenBank \|\| EMBL
5.	AL591512	GenBank \|\| EMBL
6.	BC061041	GenBank \|\| EMBL