AMPDB_4626 | WAP four-disulfide core domain protein 12

PEPTIDE SUMMARY

WAP four-disulfide core domain protein 12

1 General Description

AMPDB ID: AMPDB_4626

Protein Names: WAP four-disulfide core domain protein 12 (Elafin-like protein II) (Single WAP motif protein 2) (Whey acidic protein 2)

Protein Family: Nil

Gene Name: Wfdc12 Swam2

Source Organism: Mus musculus (Mouse)

Protein Length: 85 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MWPNSILVLMTLLISSTLVTGGGVKGEEKRVCPPDYVRCIRQDDPQCYSDNDCGDQEICCFWQCGFKCVLPVKDNSEEQIPQSKV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 3, 'N': 3, 'D': 7, 'C': 8, 'Q': 6, 'E': 5, 'G': 6, 'H': 0, 'I': 5, 'L': 6, 'K': 5, 'M': 2, 'F': 2, 'P': 6, 'S': 6, 'T': 3, 'W': 2, 'Y': 2, 'V': 8

Frequencies of Amino Acids

'A': 0%, 'R': 3.53%, 'N': 3.53%, 'D': 8.24%, 'C': 9.41%, 'Q': 7.06%, 'E': 5.88%, 'G': 7.06%, 'H': 0%, 'I': 5.88%, 'L': 7.06%, 'K': 5.88%, 'M': 2.35%, 'F': 2.35%, 'P': 7.06%, 'S': 7.06%, 'T': 3.53%, 'W': 2.35%, 'Y': 2.35%, 'V': 9.41%

Missing Amino Acid(s)

A, H

Most Occurring Amino Acid(s)

C, V

Less Occurring Amino Acid(s)

F, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9558.98 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.765	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.629	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.253	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.62	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.315	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.489	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.294, 0.247, 0.153 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.071	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14480	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Serine protease inhibitor

4.5 Other Biological Activity

Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hagiwara K, Kikuchi T, Endo Y, et al. Mouse SWAM1 and SWAM2 are antibacterial proteins composed of a single whey acidic protein motif. J Immunol. 2003;170(4):1973-9. Published 2003 Feb 15. doi:10.4049/jimmunol.170.4.1973

PMID: 12574366

Citation 2: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

5.2 Protein Sequence Databases

UniProt: Q9JHY3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q9JHY3

5.4 Nucleotide Sequence Databases