AMPDB_4609 | Cecropin-B type 2
PEPTIDE SUMMARY
Cecropin-B type 2
1 General Description
AMPDB ID: AMPDB_4609
Protein Names: Cecropin-B type 2 (Cecropin-B2) [Cleaved into: Cecropin-B (AalCecB); Cecropin-B amidated isoform]
Protein Family: Cecropin family
Gene Name: CECB2
Protein Length: 60 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MNFSKLFALVLLIGLVLLTGQTEAGGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIGK
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 5, 'R': 1, 'N': 1, 'D': 0, 'C': 0, 'Q': 1, 'E': 3, 'G': 9, 'H': 0, 'I': 2, 'L': 12, 'K': 10, 'M': 1, 'F': 3, 'P': 1, 'S': 2, 'T': 3, 'W': 0, 'Y': 1, 'V': 5
Frequencies of Amino Acids
'A': 8.33%, 'R': 1.67%, 'N': 1.67%, 'D': 0%, 'C': 0%, 'Q': 1.67%, 'E': 5%, 'G': 15%, 'H': 0%, 'I': 3.33%, 'L': 20%, 'K': 16.67%, 'M': 1.67%, 'F': 5%, 'P': 1.67%, 'S': 3.33%, 'T': 5%, 'W': 0%, 'Y': 1.67%, 'V': 8.33%
Missing Amino Acid(s)
C, D, H, W
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
M, N, P, Q, R, Y
Hydrophobic Amino Acid(s) Count
38
Hydrophilic Amino Acid(s) Count
22
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 6344.77 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 123.5 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 9.588 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.395 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.719 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.992 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 8 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.383, 0.217, 0.35 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.067 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1490 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Sun D, Eccleston ED, Fallon AM, et al. Cloning and expression of three cecropin cDNAs from a mosquito cell line. FEBS Lett. 1999;454(1-2):147-51. Published 1999 Jul 2. doi:10.1016/s0014-5793(99)00799-1
PMID: 10413113
5.2 Protein Sequence Databases
UniProt: Q963A9
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q963A9
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF394746 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR000875, IPR020400
PANTHER: PTHR38329
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India