AMPDB_4594 | Cecropin-1 3

PEPTIDE SUMMARY

Cecropin-1 3

1 General Description

AMPDB ID: AMPDB_4594

Protein Names: Cecropin-1 3

Protein Family: Cecropin family

Gene Name: Cec1 GJ10758; Cec3 GJ10755

Source Organism: Drosophila virilis (Fruit fly)

Protein Length: 63 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MNFYKVFIFVALILAISLGQSEAGWLKKIGKKIERIGQHTRDATIQGLGIAQQAANVAATARG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 3, 'N': 2, 'D': 1, 'C': 0, 'Q': 5, 'E': 2, 'G': 7, 'H': 1, 'I': 8, 'L': 5, 'K': 5, 'M': 1, 'F': 3, 'P': 0, 'S': 2, 'T': 3, 'W': 1, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 15.87%, 'R': 4.76%, 'N': 3.17%, 'D': 1.59%, 'C': 0%, 'Q': 7.94%, 'E': 3.17%, 'G': 11.11%, 'H': 1.59%, 'I': 12.7%, 'L': 7.94%, 'K': 7.94%, 'M': 1.59%, 'F': 4.76%, 'P': 0%, 'S': 3.17%, 'T': 4.76%, 'W': 1.59%, 'Y': 1.59%, 'V': 4.76%

Missing Amino Acid(s)

C, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6784.97 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	110.159	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	29.038	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.254	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.95	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.987	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.091	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.333, 0.175, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.079	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhou X, Nguyen T, Kimbrell DA, et al. Identification and characterization of the Cecropin antibacterial protein gene locus in Drosophila virilis. J Mol Evol. 1997;44(3):272-81. Published 1997 Mar. doi:10.1007/pl00006144

PMID: 9060393

Citation 2: Clark AG, Eisen MB, Smith DR, et al. Evolution of genes and genomes on the Drosophila phylogeny. Nature. 2007;450(7167):203-18. Published 2007 Nov 8. doi:10.1038/nature06341

PMID: 17994087

5.2 Protein Sequence Databases

UniProt: Q94557

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q94557

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U71249	GenBank \|\| EMBL
2.	U71249	GenBank \|\| EMBL
3.	CH940652	GenBank \|\| EMBL
4.	CH940652	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_002056105.1, XP_002056107.2

5.5 Protein-Protein Interaction Databases

STRING: 7244.FBpp0225172

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: dvi:6632628, dvi:6632630

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download