AMPDB_4566 | Ranatuerin-2P

PEPTIDE SUMMARY

Ranatuerin-2P

1 General Description

AMPDB ID: AMPDB_4566

Protein Names: Ranatuerin-2P

Protein Family: Frog skin active peptide (FSAP) family; Ranatuerin subfamily

Gene Name: Nil

Source Organism: Lithobates pipiens (Northern leopard frog) (Rana pipiens)

Protein Length: 71 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTMKKSLLLFFFLGTISLSLCEQERGADEDDGVEITEEEVKRGLMDTVKNVAKNLAGHMLDKLKCKITGC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 2, 'D': 5, 'C': 3, 'Q': 1, 'E': 7, 'G': 6, 'H': 1, 'I': 3, 'L': 10, 'K': 8, 'M': 4, 'F': 4, 'P': 0, 'S': 3, 'T': 5, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 4.23%, 'R': 2.82%, 'N': 2.82%, 'D': 7.04%, 'C': 4.23%, 'Q': 1.41%, 'E': 9.86%, 'G': 8.45%, 'H': 1.41%, 'I': 4.23%, 'L': 14.08%, 'K': 11.27%, 'M': 5.63%, 'F': 5.63%, 'P': 0%, 'S': 4.23%, 'T': 7.04%, 'W': 0%, 'Y': 0%, 'V': 5.63%

Missing Amino Acid(s)

P, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7941.32 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.972	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	22.311	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.059	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.687	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.065	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.085	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.296, 0.155, 0.338 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Chen T, Farragher S, Bjourson AJ, et al. Granular gland transcriptomes in stimulated amphibian skin secretions. Biochem J. 2003;371(Pt 1):125-30. Published 2003 Apr 1. doi:10.1042/BJ20021343

PMID: 12413397

Citation 2: Goraya J, Wang Y, Li Z, et al. Peptides with antimicrobial activity from four different families isolated from the skins of the North American frogs Rana luteiventris, Rana berlandieri and Rana pipiens. Eur J Biochem. 2000;267(3):894-900. Published 2000 Feb. doi:10.1046/j.1432-1327.2000.01074.x

PMID: 10651828

5.2 Protein Sequence Databases

UniProt: Q8QFQ4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8QFQ4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ427747	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012521, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download