AMPDB_4562 | Antimicrobial peptide ISAMP

PEPTIDE SUMMARY

Antimicrobial peptide ISAMP

1 General Description

AMPDB ID: AMPDB_4562

Protein Names: Antimicrobial peptide ISAMP

Protein Family: Nil

Gene Name: Nil

Source Organism: Ixodes scapularis (Black-legged tick) (Deer tick)

Protein Length: 69 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRAVAIFIVTLLVLECVYFVMSEPDPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 7, 'N': 2, 'D': 3, 'C': 7, 'Q': 2, 'E': 3, 'G': 5, 'H': 1, 'I': 3, 'L': 4, 'K': 2, 'M': 2, 'F': 2, 'P': 6, 'S': 4, 'T': 2, 'W': 2, 'Y': 2, 'V': 7

Frequencies of Amino Acids

'A': 4.35%, 'R': 10.14%, 'N': 2.9%, 'D': 4.35%, 'C': 10.14%, 'Q': 2.9%, 'E': 4.35%, 'G': 7.25%, 'H': 1.45%, 'I': 4.35%, 'L': 5.8%, 'K': 2.9%, 'M': 2.9%, 'F': 2.9%, 'P': 8.7%, 'S': 5.8%, 'T': 2.9%, 'W': 2.9%, 'Y': 2.9%, 'V': 10.14%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

C, R, V

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7817.15 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	73.333	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.497	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.112	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.463	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.286	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.659	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.29, 0.246, 0.174 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.087	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cereus (Gram-positive), B.subtilis (Gram-positive), E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Valenzuela JG, Francischetti IM, Pham VM, et al. Exploring the sialome of the tick Ixodes scapularis. J Exp Biol. 2002;205(Pt 18):2843-64. Published 2002 Sep. doi:10.1242/jeb.205.18.2843

PMID: 12177149

Citation 2: Pichu S, Ribeiro JM, Mather TN, et al. Purification and characterization of a novel salivary antimicrobial peptide from the tick, Ixodes scapularis. Biochem Biophys Res Commun. 2009;390(3):511-5. Published 2009 Dec 18. doi:10.1016/j.bbrc.2009.09.127

PMID: 19852941

5.2 Protein Sequence Databases

UniProt: Q8MVA6

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8MVA6

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF483734	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download