AMPDB_4550 | Moricin

PEPTIDE SUMMARY

Moricin

1 General Description

AMPDB ID: AMPDB_4550

Protein Names: Moricin

Protein Family: Moricin family

Gene Name: Nil

Source Organism: Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Protein Length: 67 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKLTSLFIFVIVALSLLFSSTDAAPGKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 2, 'N': 1, 'D': 2, 'C': 0, 'Q': 1, 'E': 0, 'G': 5, 'H': 2, 'I': 7, 'L': 6, 'K': 10, 'M': 1, 'F': 5, 'P': 3, 'S': 5, 'T': 4, 'W': 0, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 10.45%, 'R': 2.99%, 'N': 1.49%, 'D': 2.99%, 'C': 0%, 'Q': 1.49%, 'E': 0%, 'G': 7.46%, 'H': 2.99%, 'I': 10.45%, 'L': 8.96%, 'K': 14.93%, 'M': 1.49%, 'F': 7.46%, 'P': 4.48%, 'S': 7.46%, 'T': 5.97%, 'W': 0%, 'Y': 0%, 'V': 8.96%

Missing Amino Acid(s)

C, E, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, N, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7205.74 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	112.09	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	20.785	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.388	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.783	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.647	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.178	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.358, 0.209, 0.209 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.075	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), K.pneumoniae (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive), S.typhimurium, Serratia marcescens (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-MRSA, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhu Y, Johnson TJ, Myers AA, et al. Identification by subtractive suppression hybridization of bacteria-induced genes expressed in Manduca sexta fat body. Insect Biochem Mol Biol. 2003;33(5):541-59. Published 2003 May. doi:10.1016/s0965-1748(03)00028-6

PMID: 12706633

Citation 2: Gorman MJ, Kankanala P, Kanost MR, et al. Bacterial challenge stimulates innate immune responses in extra-embryonic tissues of tobacco hornworm eggs. Insect Mol Biol. 2004;13(1):19-24. Published 2004 Feb. doi:10.1111/j.1365-2583.2004.00454.x

PMID: 14728663

Citation 3: Dai H, Rayaprolu S, Gong Y, et al. Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin. J Pept Sci. 2008;14(7):855-63. Published 2008 Jul. doi:10.1002/psc.1016

PMID: 18265434

5.2 Protein Sequence Databases

UniProt: Q86MA1

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q86MA1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY232301	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR009456, IPR037043

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download