AMPDB_4544 | Phylloseptin-B1

PEPTIDE SUMMARY

Phylloseptin-B1

1 General Description

AMPDB ID: AMPDB_4544

Protein Names: Phylloseptin-B1 (PLS-B1) (Dermaseptin PBN1) (DRP-PBN1)

Protein Family: Frog skin active peptide (FSAP) family; Phylloseptin subfamily

Gene Name: Nil

Source Organism: Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)

Protein Length: 66 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSICEEEKRETEEKEYDQGEDDKSEEKRFLSLIPHIVSGVAALAKHLG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 2, 'N': 0, 'D': 3, 'C': 1, 'Q': 1, 'E': 10, 'G': 4, 'H': 2, 'I': 3, 'L': 11, 'K': 7, 'M': 1, 'F': 4, 'P': 1, 'S': 6, 'T': 1, 'W': 0, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 6.06%, 'R': 3.03%, 'N': 0%, 'D': 4.55%, 'C': 1.52%, 'Q': 1.52%, 'E': 15.15%, 'G': 6.06%, 'H': 3.03%, 'I': 4.55%, 'L': 16.67%, 'K': 10.61%, 'M': 1.52%, 'F': 6.06%, 'P': 1.52%, 'S': 9.09%, 'T': 1.52%, 'W': 0%, 'Y': 1.52%, 'V': 6.06%

Missing Amino Acid(s)

N, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, P, Q, T, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7466.63 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	106.364	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	54.917	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.103	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.674	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.805	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.866	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.348, 0.167, 0.394 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.076	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1490	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.megaterium, S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Synergistic peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Vanhoye D, Bruston F, Nicolas P, et al. Antimicrobial peptides from hylid and ranin frogs originated from a 150-million-year-old ancestral precursor with a conserved signal peptide but a hypermutable antimicrobial domain. Eur J Biochem. 2003;270(9):2068-81. Published 2003 May. doi:10.1046/j.1432-1033.2003.03584.x

PMID: 12709067

Citation 2: Vanhoye D, Bruston F, El Amri S, et al. Membrane association, electrostatic sequestration, and cytotoxicity of Gly-Leu-rich peptide orthologs with differing functions. Biochemistry. 2004;43(26):8391-409. Published 2004 Jul 6. doi:10.1021/bi0493158

PMID: 15222751

Citation 3: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017

PMID: 18644413

5.2 Protein Sequence Databases

UniProt: Q800R3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q800R3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY218784	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download