AMPDB_4535 | Beta-defensin 38
PEPTIDE SUMMARY
Beta-defensin 38
1 General Description
AMPDB ID: AMPDB_4535
Protein Names: Beta-defensin 38 (BD-38) (mBD-38) (Defensin; beta 38)
Protein Family: Beta-defensin family
Gene Name: Defb38
Source Organism: Mus musculus (Mouse)
Protein Length: 63 AA
Protein Existence: Evidence at transcript level
2 Protein Sequence & Composition
2.1 Sequence
MKISCFLLLILSLYFFQINQAIGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 2, 'R': 2, 'N': 2, 'D': 1, 'C': 7, 'Q': 4, 'E': 1, 'G': 4, 'H': 1, 'I': 4, 'L': 6, 'K': 8, 'M': 1, 'F': 4, 'P': 2, 'S': 3, 'T': 2, 'W': 1, 'Y': 6, 'V': 2
Frequencies of Amino Acids
'A': 3.17%, 'R': 3.17%, 'N': 3.17%, 'D': 1.59%, 'C': 11.11%, 'Q': 6.35%, 'E': 1.59%, 'G': 6.35%, 'H': 1.59%, 'I': 6.35%, 'L': 9.52%, 'K': 12.7%, 'M': 1.59%, 'F': 6.35%, 'P': 3.17%, 'S': 4.76%, 'T': 3.17%, 'W': 1.59%, 'Y': 9.52%, 'V': 3.17%
Missing Amino Acid(s)
No Amino Acid(s) are missing in this protein
Most Occurring Amino Acid(s)
K
Less Occurring Amino Acid(s)
D, E, H, M, W
Hydrophobic Amino Acid(s) Count
26
Hydrophilic Amino Acid(s) Count
37
Basic Amino Acid(s) Count
2
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7442.9 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 74.286 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 38.06 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.084 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.551 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 9.313 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 7.65 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.365, 0.175, 0.159 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.175 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 14440, 14815 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), E.faecium (Gram-positive), P.aeruginosa (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Zaballos A, Villares R, Albar JP, et al. Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ. J Biol Chem. 2004;279(13):12421-6. Published 2004 Mar 26. doi:10.1074/jbc.M307697200
PMID: 14718547
5.2 Protein Sequence Databases
UniProt: Q7TNV7
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q7TNV7
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AJ575424 GenBank || EMBL
2. AJ578471 GenBank || EMBL
RefSeq: NP_898857.1
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR001855
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
5.9 Phylogenomic Databases
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Q7TNV7




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India