AMPDB_4528 | L-cystatin

PEPTIDE SUMMARY

L-cystatin

1 General Description

AMPDB ID: AMPDB_4528

Protein Names: L-cystatin

Protein Family: Cystatin family

Gene Name: Nil

Source Organism: Tachypleus tridentatus (Japanese horseshoe crab)

Protein Length: 133 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MEGYNILAVLIILVGVSMGQIPGGWIDANVGDTDVKEAARFATEAQSSRSNSLYHHKLLKIHKARTQVVSGINYEVFIETGTTTCKKSEVPLEDLKRCAVPENGVKHLCQAIVWVQAWIPRTKVTKLECQNKG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 5, 'N': 6, 'D': 4, 'C': 4, 'Q': 6, 'E': 9, 'G': 10, 'H': 4, 'I': 10, 'L': 10, 'K': 11, 'M': 2, 'F': 2, 'P': 4, 'S': 7, 'T': 9, 'W': 3, 'Y': 3, 'V': 14

Frequencies of Amino Acids

'A': 7.52%, 'R': 3.76%, 'N': 4.51%, 'D': 3.01%, 'C': 3.01%, 'Q': 4.51%, 'E': 6.77%, 'G': 7.52%, 'H': 3.01%, 'I': 7.52%, 'L': 7.52%, 'K': 8.27%, 'M': 1.5%, 'F': 1.5%, 'P': 3.01%, 'S': 5.26%, 'T': 6.77%, 'W': 2.26%, 'Y': 2.26%, 'V': 10.53%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14691 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	96.692	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.546	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.116	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.675	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.643	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.126	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.316, 0.203, 0.233 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.06	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	20970, 21220	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Thiol protease inhibitor

4.5 Other Biological Activity

Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Agarwala KL, Kawabata S, Hirata M, et al. A cysteine protease inhibitor stored in the large granules of horseshoe crab hemocytes: purification, characterization, cDNA cloning and tissue localization. J Biochem. 1996;119(1):85-94. Published 1996 Jan. doi:10.1093/oxfordjournals.jbchem.a021220

PMID: 8907180

5.2 Protein Sequence Databases

UniProt: Q7M429

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q7M429

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000010, IPR046350, IPR018073

PANTHER: Not found

PROSITE: PS00287

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download