AMPDB_452 | U-poneritoxin
PEPTIDE SUMMARY
U-poneritoxin
1 General Description
AMPDB ID: AMPDB_452
Protein Names: U-poneritoxin(01)-Om4a (U-PONTX(01)-Om4a) (Pilosulin-like peptide 4) (PLP4) (Poneratoxin)
Protein Family: Formicidae venom precursor-01 superfamily
Gene Name: Nil
Protein Length: 68 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKPSSLTLAFLVVFMMAIMYNSVQAEALADADAEAFAEAGVKELFGKAWGLVKKHLPKACGLLGYVKQ
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 12, 'R': 0, 'N': 1, 'D': 2, 'C': 1, 'Q': 2, 'E': 4, 'G': 5, 'H': 1, 'I': 1, 'L': 9, 'K': 7, 'M': 4, 'F': 4, 'P': 2, 'S': 3, 'T': 1, 'W': 1, 'Y': 2, 'V': 6
Frequencies of Amino Acids
'A': 17.65%, 'R': 0%, 'N': 1.47%, 'D': 2.94%, 'C': 1.47%, 'Q': 2.94%, 'E': 5.88%, 'G': 7.35%, 'H': 1.47%, 'I': 1.47%, 'L': 13.24%, 'K': 10.29%, 'M': 5.88%, 'F': 5.88%, 'P': 2.94%, 'S': 4.41%, 'T': 1.47%, 'W': 1.47%, 'Y': 2.94%, 'V': 8.82%
Missing Amino Acid(s)
R
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
C, H, I, N, T, W
Hydrophobic Amino Acid(s) Count
44
Hydrophilic Amino Acid(s) Count
24
Basic Amino Acid(s) Count
6
Acidic Amino Acid(s) Count
8
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7319.73 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 100.588 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 24.269 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.485 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.479 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.488 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 1.031 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.338, 0.162, 0.426 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.103 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 8480, 8480 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), S.aureus (Gram-positive), S.cerevisiae
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-yeast, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Kazuma K, Masuko K, Konno K, et al. Combined Venom Gland Transcriptomic and Venom Peptidomic Analysis of the Predatory Ant Odontomachus monticola. Toxins (Basel). 2017;9(10). Published 2017 Oct 13. doi:10.3390/toxins9100323
PMID: 29027956
Citation 2: Tani N, Kazuma K, Ohtsuka Y, et al. Mass Spectrometry Analysis and Biological Characterization of the Predatory Ant Odontomachus monticola Venom and Venom Sac Components. Toxins (Basel). 2019;11(1). Published 2019 Jan 17. doi:10.3390/toxins11010050
PMID: 30658410
5.2 Protein Sequence Databases
UniProt: A0A348G5W0
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: A0A348G5W0
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. FX985497 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India