AMPDB_4497 | Theromacin

PEPTIDE SUMMARY

Theromacin

1 General Description

AMPDB ID: AMPDB_4497

Protein Names: Theromacin

Protein Family: Macin family

Gene Name: Nil

Source Organism: Theromyzon tessulatum (Duck leech)

Protein Length: 97 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MELKSGLSILLCFGICIAVINAGCFEDWSRCSPSTSRGTGVLWRDCDSYCKVCFKADRGECFDSPSLNCPQRLPNNKQCRCINARTAKDNRNPTCWA

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 8, 'N': 7, 'D': 6, 'C': 12, 'Q': 2, 'E': 3, 'G': 6, 'H': 0, 'I': 5, 'L': 7, 'K': 5, 'M': 1, 'F': 4, 'P': 5, 'S': 9, 'T': 4, 'W': 3, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 6.19%, 'R': 8.25%, 'N': 7.22%, 'D': 6.19%, 'C': 12.37%, 'Q': 2.06%, 'E': 3.09%, 'G': 6.19%, 'H': 0%, 'I': 5.15%, 'L': 7.22%, 'K': 5.15%, 'M': 1.03%, 'F': 4.12%, 'P': 5.15%, 'S': 9.28%, 'T': 4.12%, 'W': 3.09%, 'Y': 1.03%, 'V': 3.09%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10818.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	63.402	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.596	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.281	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.544	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.152	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.26	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.237, 0.278, 0.175 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	17990, 18740	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tasiemski A, Vandenbulcke F, Mitta G, et al. Molecular characterization of two novel antibacterial peptides inducible upon bacterial challenge in an annelid, the leech Theromyzon tessulatum. J Biol Chem. 2004;279(30):30973-82. Published 2004 Jul 23. doi:10.1074/jbc.M312156200

PMID: 15102860

5.2 Protein Sequence Databases

UniProt: Q6T6C2

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q6T6C2

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY434032	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR029230, IPR038456

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download