AMPDB_4496 | Theromyzin

PEPTIDE SUMMARY

Theromyzin

1 General Description

AMPDB ID: AMPDB_4496

Protein Names: Theromyzin

Protein Family: Nil

Gene Name: Nil

Source Organism: Theromyzon tessulatum (Duck leech)

Protein Length: 107 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MHAKIILALFLGMTAFLAVQADHHHDHGHDDHEHEELTLEKIKEKIKDYADKTPVDQLTERVQAGRDYLLGKGARPSHLPARVDRHLSKLTAAEKQELADYLLTFLH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 5, 'N': 0, 'D': 10, 'C': 0, 'Q': 4, 'E': 8, 'G': 5, 'H': 11, 'I': 4, 'L': 16, 'K': 9, 'M': 2, 'F': 3, 'P': 3, 'S': 2, 'T': 6, 'W': 0, 'Y': 3, 'V': 4

Frequencies of Amino Acids

'A': 11.21%, 'R': 4.67%, 'N': 0%, 'D': 9.35%, 'C': 0%, 'Q': 3.74%, 'E': 7.48%, 'G': 4.67%, 'H': 10.28%, 'I': 3.74%, 'L': 14.95%, 'K': 8.41%, 'M': 1.87%, 'F': 2.8%, 'P': 2.8%, 'S': 1.87%, 'T': 5.61%, 'W': 0%, 'Y': 2.8%, 'V': 3.74%

Missing Amino Acid(s)

C, N, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	12220.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	94.953	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	24.314	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.532	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.691	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.746	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.989	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.28, 0.093, 0.355 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tasiemski A, Vandenbulcke F, Mitta G, et al. Molecular characterization of two novel antibacterial peptides inducible upon bacterial challenge in an annelid, the leech Theromyzon tessulatum. J Biol Chem. 2004;279(30):30973-82. Published 2004 Jul 23. doi:10.1074/jbc.M312156200

PMID: 15102860

5.2 Protein Sequence Databases

UniProt: Q6T6C1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q6T6C1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY434033	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download