AMPDB_4494 | Gallinacin-6

1 General Description

AMPDB ID: AMPDB_4494

Protein Names: Gallinacin-6 (Gal 6) (Beta-defensin 6) (Gallinacin-4) (Gal-4)

Protein Family: Beta-defensin family

Gene Name: GAL6

Source Organism: Gallus gallus (Chicken)

Protein Length: 67 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA

FASTA format

Counts of Amino Acids

'A': 3, 'R': 7, 'N': 1, 'D': 0, 'C': 6, 'Q': 3, 'E': 0, 'G': 7, 'H': 1, 'I': 3, 'L': 7, 'K': 1, 'M': 1, 'F': 2, 'P': 5, 'S': 6, 'T': 0, 'W': 2, 'Y': 5, 'V': 7

Frequencies of Amino Acids

'A': 4.48%, 'R': 10.45%, 'N': 1.49%, 'D': 0%, 'C': 8.96%, 'Q': 4.48%, 'E': 0%, 'G': 10.45%, 'H': 1.49%, 'I': 4.48%, 'L': 10.45%, 'K': 1.49%, 'M': 1.49%, 'F': 2.99%, 'P': 7.46%, 'S': 8.96%, 'T': 0%, 'W': 2.99%, 'Y': 7.46%, 'V': 10.45%

Missing Amino Acid(s)

D, E, T

Most Occurring Amino Acid(s)

G, L, R, V

Less Occurring Amino Acid(s)

H, K, M, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7554 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.985	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	55.312	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.312	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.508	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.677	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.712	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.388, 0.284, 0.164 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.134	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	18450, 18825	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Lynn DJ, Higgs R, Gaines S, et al. Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken. Immunogenetics. 2004;56(3):170-7. Published 2004 Jun. doi:10.1007/s00251-004-0675-0

PMID: 15148642

Citation 2: Xiao Y, Hughes AL, Ando J, et al. A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins. BMC Genomics. 2004;5(1):56. Published 2004 Aug 13. doi:10.1186/1471-2164-5-56

PMID: 15310403

Citation 3: Milona P, Townes CL, Bevan RM, et al. The chicken host peptides, gallinacins 4, 7, and 9 have antimicrobial activity against Salmonella serovars. Biochem Biophys Res Commun. 2007;356(1):169-74. Published 2007 Apr 27. doi:10.1016/j.bbrc.2007.02.098

PMID: 17346671

Citation 4: Subedi K, Isobe N, Nishibori M, et al. Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus). Reproduction. 2007;133(1):127-33. Published 2007 Jan. doi:10.1530/REP-06-0083

PMID: 17244739

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q6QLR3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY534892	GenBank \|\| EMBL
2.	AY621308	GenBank \|\| EMBL
3.	AY621321	GenBank \|\| EMBL
4.	DQ677637	GenBank \|\| EMBL
5.	DQ858303	GenBank \|\| EMBL
6.	DQ858316	GenBank \|\| EMBL
7.	DQ858329	GenBank \|\| EMBL
8.	DQ858343	GenBank \|\| EMBL

RefSeq: NP_001001193.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: gga:407776

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download