AMPDB_4490 | Midkine

PEPTIDE SUMMARY

Midkine

1 General Description

AMPDB ID: AMPDB_4490

Protein Names: Midkine (MK)

Protein Family: Pleiotrophin family

Gene Name: mdk

Source Organism: Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Protein Length: 142 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MELRAFCVILLITFLAVSSQAAKNKKEKGKKGASDCTEWTWGRCIPNSKDCGAGTREGTCKEETRKLKCKIPCNWKKAFGADCKYKFENWGECNATTGQKVRSGTLKKALYNADCQQTVEATKPCSLKTKSKSKGKKGKGKE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 5, 'N': 6, 'D': 4, 'C': 11, 'Q': 4, 'E': 10, 'G': 13, 'H': 0, 'I': 4, 'L': 8, 'K': 27, 'M': 1, 'F': 4, 'P': 3, 'S': 8, 'T': 12, 'W': 4, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 8.45%, 'R': 3.52%, 'N': 4.23%, 'D': 2.82%, 'C': 7.75%, 'Q': 2.82%, 'E': 7.04%, 'G': 9.15%, 'H': 0%, 'I': 2.82%, 'L': 5.63%, 'K': 19.01%, 'M': 0.7%, 'F': 2.82%, 'P': 2.11%, 'S': 5.63%, 'T': 8.45%, 'W': 2.82%, 'Y': 1.41%, 'V': 2.82%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15684.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	49.578	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	7.347	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.813	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.519	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.172	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	17.326	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.183, 0.211, 0.218 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.07	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	24980, 25605	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Signal peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: Q6P8F3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q6P8F3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	BC061275	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_989074.1

5.5 Protein-Protein Interaction Databases

STRING: 8364.ENSXETP00000010258

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000762, IPR020090, IPR038130, IPR020091, IPR020089, IPR037122, IPR020092

PANTHER: PTHR13850

PROSITE: PS00619, PS00620

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: xtr:394671

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download