AMPDB_4470 | Armadillidin
PEPTIDE SUMMARY
Armadillidin
1 General Description
AMPDB ID: AMPDB_4470
Protein Names: Armadillidin
Protein Family: Nil
Gene Name: Nil
Protein Length: 73 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKFFALFSFFVLCVALATAGHLGRPYIGGGGGFNRGGGFHRGGGFHRGGGFHSGGGFHRGGGFHSGGSFGYRG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 4, 'R': 6, 'N': 1, 'D': 0, 'C': 1, 'Q': 0, 'E': 0, 'G': 26, 'H': 6, 'I': 1, 'L': 4, 'K': 1, 'M': 1, 'F': 12, 'P': 1, 'S': 4, 'T': 1, 'W': 0, 'Y': 2, 'V': 2
Frequencies of Amino Acids
'A': 5.48%, 'R': 8.22%, 'N': 1.37%, 'D': 0%, 'C': 1.37%, 'Q': 0%, 'E': 0%, 'G': 35.62%, 'H': 8.22%, 'I': 1.37%, 'L': 5.48%, 'K': 1.37%, 'M': 1.37%, 'F': 16.44%, 'P': 1.37%, 'S': 5.48%, 'T': 1.37%, 'W': 0%, 'Y': 2.74%, 'V': 2.74%
Missing Amino Acid(s)
D, E, Q, W
Most Occurring Amino Acid(s)
G
Less Occurring Amino Acid(s)
C, I, K, M, N, P, T
Hydrophobic Amino Acid(s) Count
51
Hydrophilic Amino Acid(s) Count
22
Basic Amino Acid(s) Count
0
Acidic Amino Acid(s) Count
13
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7425.33 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 40.137 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 27.53 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.016 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.462 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 12.216 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 7.479 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.288, 0.438, 0.123 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.192 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 2980, 2980 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.megaterium
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Herbinière J, Braquart-Varnier C, Grève P, et al. Armadillidin: a novel glycine-rich antibacterial peptide directed against gram-positive bacteria in the woodlouse Armadillidium vulgare (Terrestrial Isopod, Crustacean). Dev Comp Immunol. 2005;29(6):489-99. Published 2005. doi:10.1016/j.dci.2004.11.001
PMID: 15752546
5.2 Protein Sequence Databases
UniProt: Q64HC7
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q64HC7
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AY644458 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India