AMPDB_4461 | Opiscorpine-1

PEPTIDE SUMMARY

Opiscorpine-1

1 General Description

AMPDB ID: AMPDB_4461

Protein Names: Opiscorpine-1

Protein Family: Long chain scorpion toxin family; Class 3 subfamily

Gene Name: Nil

Source Organism: Opistophthalmus carinatus (African yellow leg scorpion)

Protein Length: 95 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MNNKLTALIFLGLLAIASCKWFNEKSIQNKIDEKIGKNFLGGMAKAVVHKLAKNEFMCVANVDMTKSCDTHCQKASGEKGYCHGTKCKCGVPLSY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 0, 'N': 7, 'D': 3, 'C': 7, 'Q': 2, 'E': 4, 'G': 8, 'H': 3, 'I': 5, 'L': 8, 'K': 14, 'M': 4, 'F': 4, 'P': 1, 'S': 5, 'T': 4, 'W': 1, 'Y': 2, 'V': 5

Frequencies of Amino Acids

'A': 8.42%, 'R': 0%, 'N': 7.37%, 'D': 3.16%, 'C': 7.37%, 'Q': 2.11%, 'E': 4.21%, 'G': 8.42%, 'H': 3.16%, 'I': 5.26%, 'L': 8.42%, 'K': 14.74%, 'M': 4.21%, 'F': 4.21%, 'P': 1.05%, 'S': 5.26%, 'T': 4.21%, 'W': 1.05%, 'Y': 2.11%, 'V': 5.26%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

P, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10417.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.053	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	18.648	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.113	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.611	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.15	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.84	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.263, 0.221, 0.253 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.074	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

F.culmorum, F.oxysporum, P.aeruginosa (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhu S, Tytgat J, Tytgat J. The scorpine family of defensins: gene structure, alternative polyadenylation and fold recognition. Cell Mol Life Sci. 2004;61(14):1751-63. Published 2004 Jul. doi:10.1007/s00018-004-4149-1

PMID: 15241551

5.2 Protein Sequence Databases

UniProt: Q5WR03

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q5WR03

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY423481	GenBank \|\| EMBL
2.	AY423486	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR029237, IPR036574

PANTHER: Not found

PROSITE: PS51862

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download