AMPDB_4457 | Antimicrobial peptide defensin 3

PEPTIDE SUMMARY

Antimicrobial peptide defensin 3

1 General Description

AMPDB ID: AMPDB_4457

Protein Names: Antimicrobial peptide defensin 3 (AgDef3)

Protein Family: Invertebrate defensin family

Gene Name: Def3 AGAP007199

Source Organism: Anopheles gambiae (African malaria mosquito)

Protein Length: 67 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKFAVVSFLLVALLGLVAVGEAQLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 1, 'N': 4, 'D': 1, 'C': 6, 'Q': 1, 'E': 3, 'G': 6, 'H': 1, 'I': 0, 'L': 7, 'K': 4, 'M': 3, 'F': 2, 'P': 1, 'S': 4, 'T': 3, 'W': 1, 'Y': 1, 'V': 8

Frequencies of Amino Acids

'A': 14.93%, 'R': 1.49%, 'N': 5.97%, 'D': 1.49%, 'C': 8.96%, 'Q': 1.49%, 'E': 4.48%, 'G': 8.96%, 'H': 1.49%, 'I': 0%, 'L': 10.45%, 'K': 5.97%, 'M': 4.48%, 'F': 2.99%, 'P': 1.49%, 'S': 5.97%, 'T': 4.48%, 'W': 1.49%, 'Y': 1.49%, 'V': 11.94%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, P, Q, R, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6954.19 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90.299	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	23.361	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.57	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.459	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.758	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.721	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.284, 0.224, 0.343 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.06	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7365	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Meredith JM, Hurd H, Lehane MJ, et al. The malaria vector mosquito Anopheles gambiae expresses a suite of larval-specific defensin genes. Insect Mol Biol. 2008;17(2):103-12. Published 2008 Apr. doi:10.1111/j.1365-2583.2008.00786.x

PMID: 18353100

Citation 2: Holt RA, Subramanian GM, Halpern A, et al. The genome sequence of the malaria mosquito Anopheles gambiae. Science. 2002;298(5591):129-49. Published 2002 Oct 4. doi:10.1126/science.1076181

PMID: 12364791

Citation 3: Calvo E, Pham VM, Lombardo F, et al. The sialotranscriptome of adult male Anopheles gambiae mosquitoes. Insect Biochem Mol Biol. 2006;36(7):570-5. Published 2006 Jul. doi:10.1016/j.ibmb.2006.04.005

PMID: 16835022

5.2 Protein Sequence Databases

UniProt: Q5TWR9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q5TWR9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY907825	GenBank \|\| EMBL
2.	AAAB01008807	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_565009.2

5.5 Protein-Protein Interaction Databases

STRING: 7165.AGAP007199-PA

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: aga:AgaP_AGAP007199

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download