AMPDB_4448 | Defensin-1

PEPTIDE SUMMARY

Defensin-1

1 General Description

AMPDB ID: AMPDB_4448

Protein Names: Defensin-1

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Apis mellifera carnica (Carniolan honeybee)

Protein Length: 95 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKIYFIVGLLFMAMVAIMAAPVEDEFEPLEHFENEERADRHRRVTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRFG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 6, 'N': 3, 'D': 6, 'C': 6, 'Q': 1, 'E': 8, 'G': 7, 'H': 3, 'I': 4, 'L': 8, 'K': 7, 'M': 4, 'F': 7, 'P': 2, 'S': 4, 'T': 2, 'W': 1, 'Y': 1, 'V': 6

Frequencies of Amino Acids

'A': 9.47%, 'R': 6.32%, 'N': 3.16%, 'D': 6.32%, 'C': 6.32%, 'Q': 1.05%, 'E': 8.42%, 'G': 7.37%, 'H': 3.16%, 'I': 4.21%, 'L': 8.42%, 'K': 7.37%, 'M': 4.21%, 'F': 7.37%, 'P': 2.11%, 'S': 4.21%, 'T': 2.11%, 'W': 1.05%, 'Y': 1.05%, 'V': 6.32%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Q, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10717.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.053	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.038	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.081	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.526	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.743	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.087	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.284, 0.168, 0.305 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7365	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Klaudiny J, Albert S, BachanovÃ¡ K, et al. Two structurally different defensin genes, one of them encoding a novel defensin isoform, are expressed in honeybee Apis mellifera. Insect Biochem Mol Biol. 2005;35(1):11-22. Published 2005 Jan. doi:10.1016/j.ibmb.2004.09.007

PMID: 15607651

5.2 Protein Sequence Databases

UniProt: Q5J8R1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q5J8R1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY333923	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR017982, IPR001542, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download