AMPDB_4438 | Putative antimicrobial peptide clone 4
PEPTIDE SUMMARY
Putative antimicrobial peptide clone 4
1 General Description
AMPDB ID: AMPDB_4438
Protein Names: Putative antimicrobial peptide clone 4 (Non-disulfide-bridged peptide 4.23-like) (NDBP-4.23-like)
Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family
Gene Name: Nil
Protein Length: 73 AA
Protein Existence: Inferred from homology
2 Protein Sequence & Composition
2.1 Sequence
MQMKYLIPIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKRDITSQIEQYRNLQKREAELEDILANLPVY
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 5, 'R': 5, 'N': 2, 'D': 3, 'C': 1, 'Q': 4, 'E': 4, 'G': 5, 'H': 2, 'I': 9, 'L': 10, 'K': 4, 'M': 3, 'F': 4, 'P': 3, 'S': 2, 'T': 1, 'W': 0, 'Y': 3, 'V': 3
Frequencies of Amino Acids
'A': 6.85%, 'R': 6.85%, 'N': 2.74%, 'D': 4.11%, 'C': 1.37%, 'Q': 5.48%, 'E': 5.48%, 'G': 6.85%, 'H': 2.74%, 'I': 12.33%, 'L': 13.7%, 'K': 5.48%, 'M': 4.11%, 'F': 5.48%, 'P': 4.11%, 'S': 2.74%, 'T': 1.37%, 'W': 0%, 'Y': 4.11%, 'V': 4.11%
Missing Amino Acid(s)
W
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
C, T
Hydrophobic Amino Acid(s) Count
42
Hydrophilic Amino Acid(s) Count
31
Basic Amino Acid(s) Count
7
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8418.03 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 120.274 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 49.051 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.226 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.505 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 9.159 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 2.123 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.397, 0.164, 0.301 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.096 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 4470, 4470 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
C.albicans, Candida spp., Cryptococcus neoformans, E.faecalis (Gram-positive), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-biofilm, Anti-candida, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Anti-cancer, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Diego-García E, Batista CV, García-Gómez BI, et al. The Brazilian scorpion Tityus costatus Karsch: genes, peptides and function. Toxicon. 2005;45(3):273-83. Published 2005 Mar 1. doi:10.1016/j.toxicon.2004.10.014
PMID: 15683865
Citation 2: Guilhelmelli F, Vilela N, Smidt KS, et al. Activity of Scorpion Venom-Derived Antifungal Peptides against Planktonic Cells of Candida spp. and Cryptococcus neoformans and Candida albicans Biofilms. Front Microbiol. 2016;7:1844. Published 2016. doi:10.3389/fmicb.2016.01844
PMID: 27917162
5.2 Protein Sequence Databases
UniProt: Q5G8B5
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q5G8B5
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AY740686 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India