AMPDB_4419 | Lantibiotic epilancin

PEPTIDE SUMMARY

Lantibiotic epilancin

1 General Description

AMPDB ID: AMPDB_4419

Protein Names: Lantibiotic epilancin

Protein Family: Type A lantibiotic family

Gene Name: elkA

Source Organism: Staphylococcus epidermidis

Protein Length: 55 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNNSLFDLNLNKGVETQKSDLSPQSASVLKTSIKVSKKYCKGVTLTCGCNITGGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 0, 'N': 5, 'D': 2, 'C': 3, 'Q': 2, 'E': 1, 'G': 5, 'H': 0, 'I': 2, 'L': 6, 'K': 8, 'M': 1, 'F': 1, 'P': 1, 'S': 7, 'T': 5, 'W': 0, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 1.82%, 'R': 0%, 'N': 9.09%, 'D': 3.64%, 'C': 5.45%, 'Q': 3.64%, 'E': 1.82%, 'G': 9.09%, 'H': 0%, 'I': 3.64%, 'L': 10.91%, 'K': 14.55%, 'M': 1.82%, 'F': 1.82%, 'P': 1.82%, 'S': 12.73%, 'T': 9.09%, 'W': 0%, 'Y': 1.82%, 'V': 7.27%

Missing Amino Acid(s)

H, R, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, E, F, M, P, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5850.78 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	79.636	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.36	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.32	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.603	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.856	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.812	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.255, 0.327, 0.164 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.036	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1615	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: van de Kamp M, van den Hooven HW, Konings RN, et al. Elucidation of the primary structure of the lantibiotic epilancin K7 from Staphylococcus epidermidis K7. Cloning and characterisation of the epilancin-K7-encoding gene and NMR analysis of mature epilancin K7. Eur J Biochem. 1995;230(2):587-600. Published 1995 Jun 1. doi:10.1111/j.1432-1033.1995.tb20600.x

PMID: 7607233

5.2 Protein Sequence Databases

UniProt: Q57312

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q57312

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X87412	GenBank \|\| EMBL
2.	U20348	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download