AMPDB_4417 | Frenatin 3.1
PEPTIDE SUMMARY
Frenatin 3.1
1 General Description
AMPDB ID: AMPDB_4417
Protein Names: Frenatin 3.1
Protein Family: Frog skin active peptide (FSAP) family; Frenatin subfamily
Gene Name: Nil
Protein Length: 73 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MHFLKKSIFLVLFLGLVSLSICEKEKREDQNEEEVDENEEASEEKRGLMSILGKVAGNVLGGLFKPKENVQKM
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 2, 'R': 2, 'N': 4, 'D': 2, 'C': 1, 'Q': 2, 'E': 12, 'G': 6, 'H': 1, 'I': 3, 'L': 10, 'K': 9, 'M': 3, 'F': 4, 'P': 1, 'S': 5, 'T': 0, 'W': 0, 'Y': 0, 'V': 6
Frequencies of Amino Acids
'A': 2.74%, 'R': 2.74%, 'N': 5.48%, 'D': 2.74%, 'C': 1.37%, 'Q': 2.74%, 'E': 16.44%, 'G': 8.22%, 'H': 1.37%, 'I': 4.11%, 'L': 13.7%, 'K': 12.33%, 'M': 4.11%, 'F': 5.48%, 'P': 1.37%, 'S': 6.85%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 8.22%
Missing Amino Acid(s)
T, W, Y
Most Occurring Amino Acid(s)
E
Less Occurring Amino Acid(s)
C, H, P
Hydrophobic Amino Acid(s) Count
35
Hydrophilic Amino Acid(s) Count
38
Basic Amino Acid(s) Count
14
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8281.61 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 96.027 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 52.208 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.351 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.587 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.861 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -2.954 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.315, 0.219, 0.37 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.055 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Zhou M, Chen T, Walker B, et al. Novel frenatins from the skin of the Australasian giant white-lipped tree frog, Litoria infrafrenata: cloning of precursor cDNAs and identification in defensive skin secretion. Peptides. 2005;26(12):2445-51. Published 2005 Dec. doi:10.1016/j.peptides.2005.05.019
PMID: 15996792
5.2 Protein Sequence Databases
UniProt: Q571V4
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q571V4
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AJ937525 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275, IPR016322
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India