AMPDB_4409 | Lantibiotic streptococcin A-M49
PEPTIDE SUMMARY
Lantibiotic streptococcin A-M49
1 General Description
AMPDB ID: AMPDB_4409
Protein Names: Lantibiotic streptococcin A-M49 (Antibacterial peptide A-M49)
Protein Family: Type A lantibiotic family
Gene Name: scnA`; scnA``
Protein Length: 51 AA
Protein Existence: Inferred from homology
2 Protein Sequence & Composition
2.1 Sequence
MTKEHEIINSIQEVSLEELDQIIGAGKNGVFKTISHECHLNTWAFLATCCS
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 0, 'N': 3, 'D': 1, 'C': 3, 'Q': 2, 'E': 6, 'G': 3, 'H': 3, 'I': 6, 'L': 4, 'K': 3, 'M': 1, 'F': 2, 'P': 0, 'S': 4, 'T': 4, 'W': 1, 'Y': 0, 'V': 2
Frequencies of Amino Acids
'A': 5.88%, 'R': 0%, 'N': 5.88%, 'D': 1.96%, 'C': 5.88%, 'Q': 3.92%, 'E': 11.76%, 'G': 5.88%, 'H': 5.88%, 'I': 11.76%, 'L': 7.84%, 'K': 5.88%, 'M': 1.96%, 'F': 3.92%, 'P': 0%, 'S': 7.84%, 'T': 7.84%, 'W': 1.96%, 'Y': 0%, 'V': 3.92%
Missing Amino Acid(s)
P, R, Y
Most Occurring Amino Acid(s)
E, I
Less Occurring Amino Acid(s)
D, M, W
Hydrophobic Amino Acid(s) Count
22
Hydrophilic Amino Acid(s) Count
29
Basic Amino Acid(s) Count
7
Acidic Amino Acid(s) Count
6
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 5690.48 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 93.726 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 19.931 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.008 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.549 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.847 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -3.905 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.294, 0.196, 0.275 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.059 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 5500, 5625 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Hynes WL, Friend VL, Ferretti JJ, et al. Duplication of the lantibiotic structural gene in M-type 49 group A streptococcus strains producing streptococcin A-M49. Appl Environ Microbiol. 1994;60(11):4207-9. Published 1994 Nov. doi:10.1128/aem.60.11.4207-4209.1994
PMID: 7993103
5.2 Protein Sequence Databases
UniProt: Q54957
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q54957
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. L36235 GenBank || EMBL
2. L36235 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR007682
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India