AMPDB_44 | Cecropin-A2
PEPTIDE SUMMARY
Cecropin-A2
1 General Description
AMPDB ID: AMPDB_44
Protein Names: Cecropin-A2
Protein Family: Cecropin family
Gene Name: CecA2 CG1367
Source Organism: Drosophila melanogaster (Fruit fly)
Protein Length: 63 AA
Protein Existence: Evidence at transcript level
2 Protein Sequence & Composition
2.1 Sequence
MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 10, 'R': 3, 'N': 3, 'D': 1, 'C': 0, 'Q': 5, 'E': 2, 'G': 7, 'H': 1, 'I': 8, 'L': 4, 'K': 4, 'M': 1, 'F': 3, 'P': 0, 'S': 1, 'T': 4, 'W': 1, 'Y': 1, 'V': 4
Frequencies of Amino Acids
'A': 15.87%, 'R': 4.76%, 'N': 4.76%, 'D': 1.59%, 'C': 0%, 'Q': 7.94%, 'E': 3.17%, 'G': 11.11%, 'H': 1.59%, 'I': 12.7%, 'L': 6.35%, 'K': 6.35%, 'M': 1.59%, 'F': 4.76%, 'P': 0%, 'S': 1.59%, 'T': 6.35%, 'W': 1.59%, 'Y': 1.59%, 'V': 6.35%
Missing Amino Acid(s)
C, P
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
D, H, M, S, W, Y
Hydrophobic Amino Acid(s) Count
38
Hydrophilic Amino Acid(s) Count
25
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
8
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 6770.9 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 108.571 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 36.013 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.268 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.936 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.841 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 4.091 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.333, 0.175, 0.27 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.079 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 6990, 6990 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Kylsten P, Samakovlis C, Hultmark D, et al. The cecropin locus in Drosophila; a compact gene cluster involved in the response to infection. EMBO J. 1990;9(1):217-24. Published 1990 Jan. doi:10.1002/j.1460-2075.1990.tb08098.x
PMID: 2104802
Citation 2: Clark AG, Wang L, Wang L. Molecular population genetics of Drosophila immune system genes. Genetics. 1997;147(2):713-24. Published 1997 Oct. doi:10.1093/genetics/147.2.713
PMID: 9335607
Citation 3: Date A, Satta Y, Takahata N, et al. Evolutionary history and mechanism of the Drosophila cecropin gene family. Immunogenetics. 1998;47(6):417-29. Published 1998 May. doi:10.1007/s002510050379
PMID: 9553148
Citation 4: Ramos-Onsins S, Aguadé M, Aguadé M. Molecular evolution of the Cecropin multigene family in Drosophila. functional genes vs. pseudogenes. Genetics. 1998;150(1):157-71. Published 1998 Sep. doi:10.1093/genetics/150.1.157
PMID: 9725836
Citation 5: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185
PMID: 10731132
Citation 6: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083
PMID: 12537572
Citation 7: Samakovlis C, Kimbrell DA, Kylsten P, et al. The immune response in Drosophila: pattern of cecropin expression and biological activity. EMBO J. 1990;9(9):2969-76. Published 1990 Sep. doi:10.1002/j.1460-2075.1990.tb07489.x
PMID: 2390977
5.2 Protein Sequence Databases
UniProt: C0HKQ8
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: C0HKQ8
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. X16972 GenBank || EMBL
2. AF018976 GenBank || EMBL
3. AF018977 GenBank || EMBL
4. AF018978 GenBank || EMBL
5. AF018979 GenBank || EMBL
6. AF018980 GenBank || EMBL
7. AF018981 GenBank || EMBL
8. AF018982 GenBank || EMBL
9. AF018983 GenBank || EMBL
10. AF018984 GenBank || EMBL
11. AB010791 GenBank || EMBL
12. AB010792 GenBank || EMBL
13. AB010793 GenBank || EMBL
14. AB010794 GenBank || EMBL
15. AB010795 GenBank || EMBL
16. AB010796 GenBank || EMBL
17. AB010797 GenBank || EMBL
18. Y16852 GenBank || EMBL
19. Y16853 GenBank || EMBL
20. Y16855 GenBank || EMBL
21. Y16857 GenBank || EMBL
22. Y16858 GenBank || EMBL
23. Y16859 GenBank || EMBL
24. Y16861 GenBank || EMBL
25. AE014297 GenBank || EMBL
26. BT032790 GenBank || EMBL
27. BT032796 GenBank || EMBL
CCDS: Not found
RefSeq: NP_524588.1, NP_524589.1
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR000875, IPR020400
PANTHER: PTHR38329
PROSITE: PS00268
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: dme:Dmel_CG1365, dme:Dmel_CG1367
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India