AMPDB_4397 | Defensin J1-1
PEPTIDE SUMMARY
Defensin J1-1
1 General Description
AMPDB ID: AMPDB_4397
Protein Names: Defensin J1-1
Protein Family: DEFL family
Gene Name: Nil
Protein Length: 75 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MAGFSKVVATIFLMMLLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPCA
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 4, 'N': 2, 'D': 3, 'C': 8, 'Q': 1, 'E': 3, 'G': 7, 'H': 0, 'I': 3, 'L': 7, 'K': 4, 'M': 5, 'F': 7, 'P': 1, 'S': 5, 'T': 4, 'W': 0, 'Y': 0, 'V': 4
Frequencies of Amino Acids
'A': 9.33%, 'R': 5.33%, 'N': 2.67%, 'D': 4%, 'C': 10.67%, 'Q': 1.33%, 'E': 4%, 'G': 9.33%, 'H': 0%, 'I': 4%, 'L': 9.33%, 'K': 5.33%, 'M': 6.67%, 'F': 9.33%, 'P': 1.33%, 'S': 6.67%, 'T': 5.33%, 'W': 0%, 'Y': 0%, 'V': 5.33%
Missing Amino Acid(s)
H, W, Y
Most Occurring Amino Acid(s)
C
Less Occurring Amino Acid(s)
P, Q
Hydrophobic Amino Acid(s) Count
41
Hydrophilic Amino Acid(s) Count
34
Basic Amino Acid(s) Count
6
Acidic Amino Acid(s) Count
8
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8117.69 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 76.8 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 28.087 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.564 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.657 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.965 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 1.508 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.28, 0.2, 0.293 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.093 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 500 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
F.oxysporum
4.2 Antimicrobial Activity
Antimicrobial, Fungicide, Plant defense
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Meyer B, Houlné G, Pozueta-Romero J, et al. Fruit-specific expression of a defensin-type gene family in bell pepper. Upregulation during ripening and upon wounding. Plant Physiol. 1996;112(2):615-22. Published 1996 Oct. doi:10.1104/pp.112.2.615
PMID: 8883377
5.2 Protein Sequence Databases
UniProt: Q43413
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q43413
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. X95363 GenBank || EMBL
CCDS: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: PS00940
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India