AMPDB_4395 | Antimicrobial protein Ace-AMP1

PEPTIDE SUMMARY

Antimicrobial protein Ace-AMP1

1 General Description

AMPDB ID: AMPDB_4395

Protein Names: Antimicrobial protein Ace-AMP1

Protein Family: Plant LTP family

Gene Name: Nil

Source Organism: Allium cepa (Onion)

Protein Length: 132 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MVRVVSLLAASTFILLIMIISSPYANSQNICPRVNRIVTPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVNRNPGLRRNPRFQNIPRDCRNTFVRPFWWRPRIQCGRINLTDKLIYLDAEE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 20, 'N': 12, 'D': 4, 'C': 8, 'Q': 3, 'E': 2, 'G': 5, 'H': 0, 'I': 11, 'L': 13, 'K': 1, 'M': 2, 'F': 5, 'P': 10, 'S': 5, 'T': 5, 'W': 2, 'Y': 3, 'V': 11

Frequencies of Amino Acids

'A': 7.58%, 'R': 15.15%, 'N': 9.09%, 'D': 3.03%, 'C': 6.06%, 'Q': 2.27%, 'E': 1.52%, 'G': 3.79%, 'H': 0%, 'I': 8.33%, 'L': 9.85%, 'K': 0.76%, 'M': 1.52%, 'F': 3.79%, 'P': 7.58%, 'S': 3.79%, 'T': 3.79%, 'W': 1.52%, 'Y': 2.27%, 'V': 8.33%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15141.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	102.652	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	50.389	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.017	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.8	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.6	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	14.505	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.341, 0.242, 0.205 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.076	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15970	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.megaterium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Cammue BP, Thevissen K, Hendriks M, et al. A potent antimicrobial protein from onion seeds showing sequence homology to plant lipid transfer proteins. Plant Physiol. 1995;109(2):445-55. Published 1995 Oct. doi:10.1104/pp.109.2.445

PMID: 7480341

Citation 2: Tassin S, Broekaert WF, Marion D, et al. Solution structure of Ace-AMP1, a potent antimicrobial protein extracted from onion seeds. Structural analogies with plant nonspecific lipid transfer proteins. Biochemistry. 1998;37(11):3623-37. Published 1998 Mar 17. doi:10.1021/bi9723515

PMID: 9521681

5.2 Protein Sequence Databases

UniProt: Q41258

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q41258

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF004946	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036312, IPR016140

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download