AMPDB_4355 | Fungal defensin oryzeasin

PEPTIDE SUMMARY

Fungal defensin oryzeasin

1 General Description

AMPDB ID: AMPDB_4355

Protein Names: Fungal defensin oryzeasin

Protein Family: Invertebrate defensin family

Gene Name: AO090020000702

Source Organism: Aspergillus oryzae (strain ATCC 42149 RIB 40) (Yellow koji mold)

Protein Length: 69 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKLLTVAFSLLLLGQVHASPLVLDKRSSCQLGDVWDLNAADAACSASCAIQHGDKHGGHCDKNKVCVCN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 1, 'N': 3, 'D': 6, 'C': 6, 'Q': 3, 'E': 0, 'G': 5, 'H': 4, 'I': 1, 'L': 10, 'K': 5, 'M': 1, 'F': 1, 'P': 1, 'S': 6, 'T': 1, 'W': 1, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 11.59%, 'R': 1.45%, 'N': 4.35%, 'D': 8.7%, 'C': 8.7%, 'Q': 4.35%, 'E': 0%, 'G': 7.25%, 'H': 5.8%, 'I': 1.45%, 'L': 14.49%, 'K': 7.25%, 'M': 1.45%, 'F': 1.45%, 'P': 1.45%, 'S': 8.7%, 'T': 1.45%, 'W': 1.45%, 'Y': 0%, 'V': 8.7%

Missing Amino Acid(s)

E, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, I, M, P, R, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7278.42 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	98.986	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.27	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.188	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.522	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.373	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.009	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.275, 0.217, 0.275 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.029	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5875	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Machida M, Asai K, Sano M, et al. Genome sequencing and analysis of Aspergillus oryzae. Nature. 2005;438(7071):1157-61. Published 2005 Dec 22. doi:10.1038/nature04300

PMID: 16372010

Citation 2: Schneider T, Kruse T, Wimmer R, et al. Plectasin, a fungal defensin, targets the bacterial cell wall precursor Lipid II. Science. 2010;328(5982):1168-72. Published 2010 May 28. doi:10.1126/science.1185723

PMID: 20508130

5.2 Protein Sequence Databases

UniProt: Q2U3M0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q2U3M0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AP007167	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_001824978.2

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036574

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download