AMPDB_4340 | Tenecin-1

PEPTIDE SUMMARY

Tenecin-1

1 General Description

AMPDB ID: AMPDB_4340

Protein Names: Tenecin-1

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Tenebrio molitor (Yellow mealworm beetle)

Protein Length: 84 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKLTIFALVACFFILQIAAFPLEEAATAEEIEQGEHIRVKRVTCDILSVEAKGVKLNDAACAAHCLFRGRSGGYCNGKRVCVCR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 6, 'N': 2, 'D': 2, 'C': 7, 'Q': 2, 'E': 7, 'G': 6, 'H': 2, 'I': 6, 'L': 7, 'K': 5, 'M': 1, 'F': 5, 'P': 1, 'S': 2, 'T': 3, 'W': 0, 'Y': 1, 'V': 7

Frequencies of Amino Acids

'A': 14.29%, 'R': 7.14%, 'N': 2.38%, 'D': 2.38%, 'C': 8.33%, 'Q': 2.38%, 'E': 8.33%, 'G': 7.14%, 'H': 2.38%, 'I': 7.14%, 'L': 8.33%, 'K': 5.95%, 'M': 1.19%, 'F': 5.95%, 'P': 1.19%, 'S': 2.38%, 'T': 3.57%, 'W': 0%, 'Y': 1.19%, 'V': 8.33%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, P, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9175.82 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	98.81	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	59.706	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.364	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.636	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.046	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.757	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.31, 0.131, 0.321 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.071	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1865	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Moon HJ, Lee SY, Kurata S, et al. Purification and molecular cloning of cDNA for an inducible antibacterial protein from larvae of the coleopteran, Tenebrio molitor. J Biochem. 1994;116(1):53-8. Published 1994 Jul. doi:10.1093/oxfordjournals.jbchem.a124502

PMID: 7798186

5.2 Protein Sequence Databases

UniProt: Q27023

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q27023

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	D17670	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download