AMPDB_4339 | Attacin

PEPTIDE SUMMARY

Attacin

1 General Description

AMPDB ID: AMPDB_4339

Protein Names: Attacin (Nuecin)

Protein Family: Attacin sarcotoxin-2 family

Gene Name: Nil

Source Organism: Bombyx mori (Silk moth)

Protein Length: 214 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MSKSVALLLLCACLASGRHVPTRARRQAGSFTVNSDGTSGAALKVPLTGNDKNVLSAIGSADFNDRHKLSAASAGLALDNVNGHGLSLTGTRIPGFGEQLGVAGKVNLFHNNNHDLSAKAFAIRNSPSAIPNAPNFNTLGGGVDYMFKQKVGASLSAAHSDVINRNDYSAGGKLNLFRSPSSSLDFNAGFKKFDTPFYRSSWEPNVGFSFSKFF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 24, 'R': 10, 'N': 19, 'D': 11, 'C': 2, 'Q': 3, 'E': 2, 'G': 22, 'H': 6, 'I': 5, 'L': 21, 'K': 12, 'M': 2, 'F': 16, 'P': 9, 'S': 26, 'T': 8, 'W': 1, 'Y': 3, 'V': 12

Frequencies of Amino Acids

'A': 11.21%, 'R': 4.67%, 'N': 8.88%, 'D': 5.14%, 'C': 0.93%, 'Q': 1.4%, 'E': 0.93%, 'G': 10.28%, 'H': 2.8%, 'I': 2.34%, 'L': 9.81%, 'K': 5.61%, 'M': 0.93%, 'F': 7.48%, 'P': 4.21%, 'S': 12.15%, 'T': 3.74%, 'W': 0.47%, 'Y': 1.4%, 'V': 5.61%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

112

Hydrophilic Amino Acid(s) Count

102

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	22556.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	74.86	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.307	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.179	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.652	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.472	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.422	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.271, 0.355, 0.229 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.093	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 10095	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Sugiyama M, Kuniyoshi H, Kotani E, et al. Characterization of a Bombyx mori cDNA encoding a novel member of the attacin family of insect antibacterial proteins. Insect Biochem Mol Biol. 1995;25(3):385-92. Published 1995 Mar. doi:10.1016/0965-1748(94)00080-2

PMID: 7773256

Citation 2: Taniai K, Ishii T, Sugiyama M, et al. Nucleotide sequence of 5'-upstream region and expression of a silkworm gene encoding a new member of the attacin family. Biochem Biophys Res Commun. 1996;220(3):594-9. Published 1996 Mar 27. doi:10.1006/bbrc.1996.0448

PMID: 8607809

5.2 Protein Sequence Databases

UniProt: Q26431

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q26431

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	S78369	GenBank \|\| EMBL
2.	AF005384	GenBank \|\| EMBL
3.	D76418	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001037006.1

5.5 Protein-Protein Interaction Databases

STRING: 7091.BGIBMGA002747-TA

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR005521, IPR005520

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: bmor:692555

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download