AMPDB_4336 | Hemocyte defensin Cg-Defh1

PEPTIDE SUMMARY

Hemocyte defensin Cg-Defh1

1 General Description

AMPDB ID: AMPDB_4336

Protein Names: Hemocyte defensin Cg-Defh1

Protein Family: Invertebrate defensin family

Gene Name: Nil

Source Organism: Crassostrea gigas (Pacific oyster) (Crassostrea angulata)

Protein Length: 60 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

LFTLVVLLMVSADMAFAGFGCPRDQYKCNSHCQSIGCRAGYCDAVTLWLRCTCTDCNGKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 3, 'N': 2, 'D': 4, 'C': 8, 'Q': 2, 'E': 0, 'G': 5, 'H': 1, 'I': 1, 'L': 6, 'K': 3, 'M': 2, 'F': 3, 'P': 1, 'S': 3, 'T': 4, 'W': 1, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 8.33%, 'R': 5%, 'N': 3.33%, 'D': 6.67%, 'C': 13.33%, 'Q': 3.33%, 'E': 0%, 'G': 8.33%, 'H': 1.67%, 'I': 1.67%, 'L': 10%, 'K': 5%, 'M': 3.33%, 'F': 5%, 'P': 1.67%, 'S': 5%, 'T': 6.67%, 'W': 1.67%, 'Y': 3.33%, 'V': 6.67%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, I, P, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6586.73 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	73.167	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.778	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.277	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.476	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.97	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.592	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.283, 0.183, 0.217 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.1	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Gonzalez M, Gueguen Y, Desserre G, et al. Molecular characterization of two isoforms of defensin from hemocytes of the oyster Crassostrea gigas. Dev Comp Immunol. 2007;31(4):332-9. Published 2007. doi:10.1016/j.dci.2006.07.006

PMID: 16962661

Citation 2: Schmitt P, Wilmes M, PugniÃ¨re M, et al. Insight into invertebrate defensin mechanism of action: oyster defensins inhibit peptidoglycan biosynthesis by binding to lipid II. J Biol Chem. 2010;285(38):29208-16. Published 2010 Sep 17. doi:10.1074/jbc.M110.143388

PMID: 20605792

5.2 Protein Sequence Databases

UniProt: Q20A06

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q20A06

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	DQ400101	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download