AMPDB_432 | Bombinins BLP-7 H-BO

PEPTIDE SUMMARY

Bombinins BLP-7 H-BO

1 General Description

AMPDB ID: AMPDB_432

Protein Names: Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO]

Protein Family: Bombinin family

Gene Name: Nil

Source Organism: Bombina orientalis (Oriental fire-bellied toad)

Protein Length: 141 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 14, 'R': 9, 'N': 5, 'D': 6, 'C': 0, 'Q': 3, 'E': 16, 'G': 14, 'H': 3, 'I': 9, 'L': 18, 'K': 12, 'M': 3, 'F': 5, 'P': 2, 'S': 10, 'T': 4, 'W': 0, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 9.93%, 'R': 6.38%, 'N': 3.55%, 'D': 4.26%, 'C': 0%, 'Q': 2.13%, 'E': 11.35%, 'G': 9.93%, 'H': 2.13%, 'I': 6.38%, 'L': 12.77%, 'K': 8.51%, 'M': 2.13%, 'F': 3.55%, 'P': 1.42%, 'S': 7.09%, 'T': 2.84%, 'W': 0%, 'Y': 1.42%, 'V': 4.26%

Missing Amino Acid(s)

C, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

P, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15453.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	96.95	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.166	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.32	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.654	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.814	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.703	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.284, 0.22, 0.362 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.05	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), M.luteus (Gram-negative), P.acnes, S.aureus (Gram-positive), S.cerevisiae

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Anti-cancer, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhou C, Wang Z, Peng X, et al. Discovery of two bombinin peptides with antimicrobial and anticancer activities from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Chem Biol Drug Des. 2018;91(1):50-61. Published 2018 Jan. doi:10.1111/cbdd.13055

PMID: 28636781

Citation 2: Ke T, Liang S, Huang J, et al. A novel PCR-based method for high throughput prokaryotic expression of antimicrobial peptide genes. BMC Biotechnol. 2012;12:10. Published 2012 Mar 23. doi:10.1186/1472-6750-12-10

PMID: 22439858

Citation 3: Wu Y, Qiang Y, Cao K, et al. Inhibitory effect of the antimicrobial peptide BLP-7 against Propionibacterium acnes and its anti-inflammatory effect on acne vulgaris. Toxicon. 2020;184:109-115. Published 2020 Sep. doi:10.1016/j.toxicon.2020.06.006

PMID: 32540219

5.2 Protein Sequence Databases

UniProt: A0A219CM62

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A219CM62

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	LT732574	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007962

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download