AMPDB_4307 | Dermaseptin-S13

PEPTIDE SUMMARY

Dermaseptin-S13

1 General Description

AMPDB ID: AMPDB_4307

Protein Names: Dermaseptin-S13 (DRS-S13)

Protein Family: Frog skin active peptide (FSAP) family; Dermaseptin subfamily

Gene Name: Nil

Source Organism: Phyllomedusa sauvagei (Sauvage`s leaf frog)

Protein Length: 73 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSICDEEKRENEDEENQEDDEQSEMRRGLRSKIKEAAKTAGKMALGFVNDMAGEQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 4, 'N': 3, 'D': 5, 'C': 1, 'Q': 3, 'E': 11, 'G': 5, 'H': 0, 'I': 2, 'L': 9, 'K': 7, 'M': 4, 'F': 4, 'P': 0, 'S': 5, 'T': 1, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 8.22%, 'R': 5.48%, 'N': 4.11%, 'D': 6.85%, 'C': 1.37%, 'Q': 4.11%, 'E': 15.07%, 'G': 6.85%, 'H': 0%, 'I': 2.74%, 'L': 12.33%, 'K': 9.59%, 'M': 5.48%, 'F': 5.48%, 'P': 0%, 'S': 6.85%, 'T': 1.37%, 'W': 0%, 'Y': 0%, 'V': 4.11%

Missing Amino Acid(s)

H, P, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8269.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	78.904	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	64.875	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.563	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.644	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.401	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-5.044	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.247, 0.178, 0.411 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.055	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lequin O, Ladram A, Chabbert L, et al. Dermaseptin S9, an alpha-helical antimicrobial peptide with a hydrophobic core and cationic termini. Biochemistry. 2006;45(2):468-80. Published 2006 Jan 17. doi:10.1021/bi051711i

PMID: 16401077

Citation 2: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017

PMID: 18644413

5.2 Protein Sequence Databases

UniProt: Q1EN11

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q1EN11

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ972909	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR022731, IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download