AMPDB_43064 | S-type pyocin domain protein

PEPTIDE SUMMARY

S-type pyocin domain protein

1 General Description

AMPDB ID: AMPDB_43064

Protein Names: S-type pyocin domain protein

Protein Family: Nil

Gene Name: cda SAMEA3710514_02426

Source Organism: Shigella flexneri

Protein Length: 91 AA

Protein Existence: Predicted

2 Protein Sequence & Composition

2.1 Sequence

MRDVQWFCPLTPVHTGTEIKPVEMPVTTITPVSDAGGLQDFIYWRPDADRTGMEPVYVILNDPLDSGRFTRKQLNKNILNMQVILVFSIQE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 5, 'N': 4, 'D': 7, 'C': 1, 'Q': 5, 'E': 4, 'G': 5, 'H': 1, 'I': 7, 'L': 7, 'K': 3, 'M': 4, 'F': 4, 'P': 8, 'S': 3, 'T': 8, 'W': 2, 'Y': 2, 'V': 9

Frequencies of Amino Acids

'A': 2.2%, 'R': 5.49%, 'N': 4.4%, 'D': 7.69%, 'C': 1.1%, 'Q': 5.49%, 'E': 4.4%, 'G': 5.49%, 'H': 1.1%, 'I': 7.69%, 'L': 7.69%, 'K': 3.3%, 'M': 4.4%, 'F': 4.4%, 'P': 8.79%, 'S': 3.3%, 'T': 8.79%, 'W': 2.2%, 'Y': 2.2%, 'V': 9.89%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, H

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10406 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90.879	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.359	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.152	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.553	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.651	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.965	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.341, 0.22, 0.187 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.088	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 13980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: A0A2Y4Y4L9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A2Y4Y4L9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	UIPR01000035	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR016128, IPR036302

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download