AMPDB_4298 | Bacteriocin hiracin-JM79

PEPTIDE SUMMARY

Bacteriocin hiracin-JM79

1 General Description

AMPDB ID: AMPDB_4298

Protein Names: Bacteriocin hiracin-JM79 (Class II sec-dependent bacteriocin)

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: hirJM79

Source Organism: Enterococcus hirae

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKKKVLKHCVILGILGTCLAGIGTGIKVDAATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 2, 'N': 5, 'D': 2, 'C': 4, 'Q': 1, 'E': 2, 'G': 11, 'H': 2, 'I': 7, 'L': 5, 'K': 9, 'M': 1, 'F': 0, 'P': 2, 'S': 0, 'T': 3, 'W': 4, 'Y': 3, 'V': 6

Frequencies of Amino Acids

'A': 6.76%, 'R': 2.7%, 'N': 6.76%, 'D': 2.7%, 'C': 5.41%, 'Q': 1.35%, 'E': 2.7%, 'G': 14.86%, 'H': 2.7%, 'I': 9.46%, 'L': 6.76%, 'K': 12.16%, 'M': 1.35%, 'F': 0%, 'P': 2.7%, 'S': 0%, 'T': 4.05%, 'W': 5.41%, 'Y': 4.05%, 'V': 8.11%

Missing Amino Acid(s)

F, S

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8156.65 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	93.514	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	5.349	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.082	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.507	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.907	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.931	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.338, 0.243, 0.176 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	26470, 26720	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Clostridium (Gram-positive), Enterococcus (Gram-positive), Lactobacillus (Gram-positive), Listeria (Gram-positive), Propionibacterium (Gram-positive), Staphylococcus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: SÃ¡nchez J, Diep DB, Herranz C, et al. Amino acid and nucleotide sequence, adjacent genes, and heterologous expression of hiracin JM79, a sec-dependent bacteriocin produced by Enterococcus hirae DCH5, isolated from Mallard ducks (Anas platyrhynchos). FEMS Microbiol Lett. 2007;270(2):227-36. Published 2007 May. doi:10.1111/j.1574-6968.2007.00673.x

PMID: 17326750

5.2 Protein Sequence Databases

UniProt: Q0Z8B6

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q0Z8B6

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	DQ664500	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_002363584.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download