AMPDB_4294 | Big defensin

PEPTIDE SUMMARY

Big defensin

1 General Description

AMPDB ID: AMPDB_4294

Protein Names: Big defensin (AiBD)

Protein Family: Big defensin family

Gene Name: Nil

Source Organism: Argopecten irradians (Bay scallop) (Aequipecten irradians)

Protein Length: 122 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MTRPSLVRCYSLFFTALIVMAIICPAWSEEIPKSRKKRAIPIAYVGMAVAPQVFRWLVRAYGAAAVTAAGVTLRRVINRSRSNDNHSCYGNRGWCRSSCRSYEREYRGGNLGVCGSYKCCVT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 15, 'N': 5, 'D': 1, 'C': 8, 'Q': 1, 'E': 4, 'G': 9, 'H': 1, 'I': 7, 'L': 6, 'K': 4, 'M': 3, 'F': 3, 'P': 5, 'S': 11, 'T': 5, 'W': 3, 'Y': 7, 'V': 11

Frequencies of Amino Acids

'A': 10.66%, 'R': 12.3%, 'N': 4.1%, 'D': 0.82%, 'C': 6.56%, 'Q': 0.82%, 'E': 3.28%, 'G': 7.38%, 'H': 0.82%, 'I': 5.74%, 'L': 4.92%, 'K': 3.28%, 'M': 2.46%, 'F': 2.46%, 'P': 4.1%, 'S': 9.02%, 'T': 4.1%, 'W': 2.46%, 'Y': 5.74%, 'V': 9.02%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13649.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	78.361	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	56.106	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.02	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.768	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.267	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	13.594	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.303, 0.246, 0.213 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.107	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	26930, 27430	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhao J, Song L, Li C, et al. Molecular cloning, expression of a big defensin gene from bay scallop Argopecten irradians and the antimicrobial activity of its recombinant protein. Mol Immunol. 2007;44(4):360-8. Published 2007 Jan. doi:10.1016/j.molimm.2006.02.025

PMID: 16597463

5.2 Protein Sequence Databases

UniProt: Q0H293

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q0H293

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	DQ334340	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR028060, IPR042033, IPR023355

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download